DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and bub3

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001007498.2 Gene:bub3 / 493224 XenbaseID:XB-GENE-955683 Length:330 Species:Xenopus tropicalis


Alignment Length:179 Identity:36/179 - (20%)
Similarity:69/179 - (38%) Gaps:40/179 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GDLDISFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFEL-----IV 127
            |..|.:..|.||........|.:|:.|:...|:  || |.....:    .|:.:.::|     :.
 Frog   120 GSWDQTVKLWDPRTPCNAGTFSQPDKVYTLSVS--GD-RLIVGTA----GRRVLVWDLRNMGYVQ 177

  Fly   128 EREGEELQGDTQWNEADELTGLSRDEYYDMKVQDIMDFI-GRIRLQ-LTKARQLQDVLRSHEARD 190
            :|....|:..|:...|           :..|...::..| ||:.:: |..:.::|.  :.:..:.
 Frog   178 QRRESSLKYQTRCIRA-----------FPNKQGYVLSSIEGRVAVEYLDPSLEVQK--KKYAFKC 229

  Fly   191 RNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIFATGGR--MHNLW 237
            ..|.|:|.:::           ..|..:....|.:.|||||.  ..|:|
 Frog   230 HRLKENNIEQI-----------YPVNAVSFHNLHNTFATGGSDGFVNIW 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 29/165 (18%)
bub3NP_001007498.2 WD40 20..302 CDD:421866 36/179 (20%)
WD40 repeat 23..60 CDD:293791
WD40 repeat 66..100 CDD:293791
WD40 repeat 105..140 CDD:293791 5/19 (26%)
WD40 repeat 147..181 CDD:293791 7/40 (18%)
WD40 repeat 188..228 CDD:293791 8/52 (15%)
WD40 repeat 243..280 CDD:293791 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.