DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and tmed1a

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001003487.1 Gene:tmed1a / 445093 ZFINID:ZDB-GENE-040801-229 Length:226 Species:Danio rerio


Alignment Length:219 Identity:86/219 - (39%)
Similarity:124/219 - (56%) Gaps:11/219 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VLLLSIAALL--LGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISF 74
            |..||...|.  ||....:..|.|.|..:.||.|||.:.:..:..:::.|||||.|  ..||:.|
Zfish     8 VCFLSFLTLCLDLGFTFGQNKDTEFTFLLPAGATECFFQTATKNSSMEVEYQVIAG--SGLDVGF 70

  Fly    75 TLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVE-REGEELQGDT 138
            ||:.|.|..:||||:|.:.:|..:..:|||||.|||||||..:.|.|:.|:|:: .|||: :.|.
Zfish    71 TLISPRGYRLVSDFRKSDGIHTVDSTEEGDYRICFDNSFSRISEKMVYVEVIMDGPEGED-EDDE 134

  Fly   139 QWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKVNH 203
            .|....|     .::..:.|::||.|.:..:...|.::||||..||:.|||||.|.|.|..:|:.
Zfish   135 DWAALAE-----PEDSLEYKLEDIRDSMDAVHKSLERSRQLQTTLRAFEARDRYLLEDNLWRVSF 194

  Fly   204 WSMVQISAMIGVGLIQVFMLRSIF 227
            ||...:..||.|.|.||:.||.:|
Zfish   195 WSCASLLVMISVALTQVYTLRRLF 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 78/194 (40%)
tmed1aNP_001003487.1 EMP24_GP25L 31..219 CDD:279450 79/196 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 159 1.000 Domainoid score I4046
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I4164
OMA 1 1.010 - - QHG49398
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm6492
orthoMCL 1 0.900 - - OOG6_108563
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1510
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.