DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and bai

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster


Alignment Length:216 Identity:46/216 - (21%)
Similarity:92/216 - (42%) Gaps:26/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AALLLGVQDAEAYDKEMTVYVDAGKTE-CLYHSVRQGETIDFEYQVIDGGHGDLDISFTLLDPIG 81
            ||.::.:..|.|:.....::..:..|: ||...::..:.:..|::|.| ..|.: |.:...|..|
  Fly     4 AAFIVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVSD-VPGQI-IDYIARDTKG 66

  Fly    82 LVIVSDFKKPENVHRHEVAKEGD----YRFCFDNSFSMFNRKTVFFELIVEREGEELQGDTQWNE 142
            .::    .:.|::.:.:.:...:    |..||.:......|..:....::.::|.|.:......|
  Fly    67 HIL----SQKEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVIQEVSLLTKKGVETKSYEGIGE 127

  Fly   143 ADELTGLSRDEYYDMK-VQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKVNHWSM 206
            |.:|..|.    .|:| ::|:.|.|.|..:.:.|        |..|.||.|  |....:|..:|:
  Fly   128 ASKLKPLE----VDLKRLEDLSDSIVRDFVLMRK--------REEEMRDTN--EKTNSRVLFFSI 178

  Fly   207 VQISAMIGVGLIQVFMLRSIF 227
            ..:..::|:...||..||..|
  Fly   179 FSMCCLLGLATWQVLYLRRYF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 41/199 (21%)
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 42/200 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.