DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and tmed4

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001002134.1 Gene:tmed4 / 415224 ZFINID:ZDB-GENE-040625-140 Length:220 Species:Danio rerio


Alignment Length:241 Identity:57/241 - (23%)
Similarity:95/241 - (39%) Gaps:48/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MPGLVLLLSIAALLLGVQDAEAYDKEMTVYVDAGKTE--CLYHSVRQGETIDFEY--QVIDGGHG 68
            |..||..:....|.:.:..::|      :|...|:||  |....:.....:...|  |:.|...|
Zfish     1 MKTLVSCVGFLLLFVWLSPSQA------LYFHIGETEKKCFIEEIPDETMVIGRYRTQLWDKQAG 59

  Fly    69 DLDISFTLLDPIGLVIVSDFKKPEN--VHRHEVAKEGDYRF----------CF-DNSFSMF---- 116
                ||....| ||.:..:.|.||.  :...:...:|.:.|          |. .||..|.    
Zfish    60 ----SFLPSTP-GLGMHVEIKDPETKVILSRQYGSDGRFTFTSHTPGEHQICLHSNSTKMALFAG 119

  Fly   117 NRKTVFFELIVEREGEELQGDTQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQD 181
            .:..|..::.|   ||......:....|:||.|      .::|:.::|       |:.:.::.|:
Zfish   120 GKLRVHLDIQV---GEHTNNYPEIAAKDKLTEL------QLRVRQLLD-------QVEQIQKEQN 168

  Fly   182 VLRSHEARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            ..|..|.|.|..:||..|:|..||:.|...:|..|:.|:..|:|.|
Zfish   169 YQRYREERFRMTSESTNQRVLWWSIAQTVILIITGIWQMKHLKSFF 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 51/214 (24%)
tmed4NP_001002134.1 EMP24_GP25L 22..215 CDD:279450 53/220 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.