DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and eca

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster


Alignment Length:237 Identity:50/237 - (21%)
Similarity:91/237 - (38%) Gaps:56/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSIAALLLGVQDAEAYDKEMTVYVDAGKTE--CLYHSVRQGETIDFEYQVIDGGHGDLDISFTLL 77
            :|:|.:|..:..|      ..:|....:||  |....|....|:...|:|            .|.
  Fly     6 ISLALILCVLHSA------CGLYFHISETERKCFIEEVPDETTVIVNYKV------------ELY 52

  Fly    78 DP-----------IGL----------VIVSDFKKPENVHRHEVAKEGDYRFC-FDNSFSMFNRKT 120
            ||           ||:          :::|.....:..........|::..| |.||.:.|:...
  Fly    53 DPRSNGFMPSSPGIGMHVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQ 117

  Fly   121 VFFELIVEREGEELQGDTQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRS 185
            :...|.:: .||.........:.::||.|      .::::.::|.:.    |:||.:..|   |.
  Fly   118 LRVHLDIQ-VGEHAIDYAHVAQKEKLTEL------QLRIRQLLDQVE----QITKEQNYQ---RY 168

  Fly   186 HEARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            .|.|.|:.:||...:|..||:.|...::.:|..|:..|:|.|
  Fly   169 REERFRHTSESTNSRVLWWSLAQTVVLVCMGFWQMRHLKSFF 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 45/217 (21%)
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 46/217 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454824
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.