DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and tmed7

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_989261.1 Gene:tmed7 / 394874 XenbaseID:XB-GENE-5847420 Length:219 Species:Xenopus tropicalis


Alignment Length:233 Identity:67/233 - (28%)
Similarity:105/233 - (45%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MPGLV------LLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGG 66
            :.|||      ..||.....||...|    .|:|..:.....:|.|..:.||.....|:|||.||
 Frog     4 LQGLVKEFRWWSFLSFVLFSLGCVRA----SELTFELPDNAKQCFYEDITQGTKCTLEFQVITGG 64

  Fly    67 HGDLDISFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREG 131
            |.|:|.  .|.||.|:|:..:.||..:.......:.|.|:|||.|.||.|..|||:|:..|    
 Frog    65 HYDVDC--RLEDPDGIVLYKEMKKQYDSFTFTATRNGTYKFCFSNEFSTFTHKTVYFDFQV---- 123

  Fly   132 EELQGDTQ--WNEADELTGLSRDEYYDMKVQD----IMDFIGRIRLQLTKARQLQDVLRSHEARD 190
                ||..  :...:..|.|::.|...:.:.:    ::|:....||:              ||:.
 Frog   124 ----GDDPPLFPNENRATALTQMESSCVSIHEALKSVIDYQTHFRLR--------------EAQG 170

  Fly   191 RNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIFA 228
            |:.||....:|.:||:.:...::.|.:.|||:|:|.|:
 Frog   171 RSRAEDLNSRVAYWSIGEAIILLVVSIGQVFLLKSFFS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 58/199 (29%)
tmed7NP_989261.1 EMP24_GP25L 31..208 CDD:366467 58/200 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.