DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and tmed5

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_956697.1 Gene:tmed5 / 393374 ZFINID:ZDB-GENE-040426-1302 Length:225 Species:Danio rerio


Alignment Length:224 Identity:91/224 - (40%)
Similarity:138/224 - (61%) Gaps:21/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VLLLSIAALLLGVQDAEAY----DKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDI 72
            ||...:|.|.:.|..|.|:    |.:.|..:.||:.||.:.::::..:::.||||:||  ..||:
Zfish     7 VLRACVACLSVCVSLASAFSQSLDSDFTFTLAAGRRECFFQTMKKDASLEIEYQVLDG--ASLDV 69

  Fly    73 SFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEELQGD 137
            .|.|..|.|.:|.||::|.:.||..| .:||||.|||||:||..:.|.:|||||::..||:.:.:
Zfish    70 DFQLNSPSGHIIASDYRKSDGVHTVE-TEEGDYMFCFDNTFSAVSEKVIFFELILDNMGEDEESE 133

  Fly   138 TQWNE----ADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNF 198
             .|..    ||.|         |||::||||.|..::.:|.|:.|:|.:||:.|||||||.|||:
Zfish   134 -DWKAYVQGADLL---------DMKLEDIMDTINNVKSRLGKSLQIQTLLRAFEARDRNLQESNY 188

  Fly   199 QKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            ::||.||...:..|:.|..:||::|||:|
Zfish   189 ERVNLWSCTNVLVMVIVSGVQVYLLRSLF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 82/197 (42%)
tmed5NP_956697.1 EMP24_GP25L 32..218 CDD:279450 83/199 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 159 1.000 Domainoid score I4046
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4996
Inparanoid 1 1.050 165 1.000 Inparanoid score I4164
OMA 1 1.010 - - QHG49398
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm6492
orthoMCL 1 0.900 - - OOG6_108563
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 1 1.000 - - X1510
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.870

Return to query results.
Submit another query.