DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and CG9308

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster


Alignment Length:236 Identity:46/236 - (19%)
Similarity:88/236 - (37%) Gaps:60/236 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFTLL 77
            :|.:|..:|:..|.|..:    .|.:||.:|.|.|......:.:...::|::||..|        
  Fly     1 MLSAIVLVLVLFQAACGF----IVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKD-------- 53

  Fly    78 DPIGLVIVSDFKKPENVHRHE------------VAKEGDYRFCFDNSFSMFNRKTVFFELIVERE 130
              :|:.|..    |::...|.            ..|||.|:.||||..|....|.:.|:..|.| 
  Fly    54 --VGVEIAG----PDDDRLHHSKQDTMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVAR- 111

  Fly   131 GEELQGDTQWNEADELTGLSRDEYY---DMKVQDIMD------FIGRIRLQLTKARQLQDVLRSH 186
                                ..|:|   ..:|.|:::      .|.::..:|...:..|:.:...
  Fly   112 --------------------AIEFYMDSSKRVDDVIEQATVQSMINQLSAKLGAVKMEQEYMHFR 156

  Fly   187 EARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            ......:::....:|..||:.....:|...:::|:.|:..|
  Fly   157 YRGHLEVSDMVELRVLAWSIFGPMMLIITAVLEVYYLKHFF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 40/214 (19%)
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 41/220 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454832
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1510
54.940

Return to query results.
Submit another query.