DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and AgaP_AGAP006043

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_556725.3 Gene:AgaP_AGAP006043 / 3290091 VectorBaseID:AGAP006043 Length:215 Species:Anopheles gambiae


Alignment Length:205 Identity:60/205 - (29%)
Similarity:90/205 - (43%) Gaps:40/205 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFTLLDPIGLVIVSDFKKPENVHRHE-- 98
            |::||||.:|.:..|:||.|:...:.||.||.|  ...|.:.:|.|          |.||.::  
Mosquito    27 VHIDAGKEDCYFQYVQQGSTLYVSFHVIRGGDG--MAGFAVRNPRG----------EIVHPYQWQ 79

  Fly    99 --------VAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEELQGDTQWNEADELTGLSRDEYY 155
                    .|..|.|..|.||.||.|..|.|...:.|.|          :.|.::.|    .|..
Mosquito    80 ASSDYTDGAAMGGFYAVCIDNQFSRFASKLVNLYITVIR----------YEEWEKFT----KEIE 130

  Fly   156 DMKVQDIMDFIGRI---RLQLTKARQLQDVLRSHEARDRNLAESNFQKVNHWSMVQISAMIGVGL 217
            |:.| ::.:|.|.|   ...|....|.|...|::||||..|...|...:..||::||..::....
Mosquito   131 DLNV-NMNNFTGTISTVERNLNAMFQYQAHSRNNEARDYALILDNNAYIWKWSVLQILVIVFTTS 194

  Fly   218 IQVFMLRSIF 227
            :||:.:|.:|
Mosquito   195 VQVYFVRKLF 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 59/203 (29%)
AgaP_AGAP006043XP_556725.3 EMP24_GP25L 24..204 CDD:279450 59/203 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.