DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and p24-1

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster


Alignment Length:206 Identity:62/206 - (30%)
Similarity:91/206 - (44%) Gaps:40/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFTLLDPIGLVIVSDFKKPENVHRH 97
            |.|..:.....:|.|..:::..:..||:||..|  |.||:..||.||.|.||.|..|...:.|:.
  Fly    21 EFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAG--GQLDVDVTLKDPQGKVIYSLEKATFDSHQF 83

  Fly    98 EVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEELQGDTQWNEADELTGLSRDEYYDMKVQDI 162
            .....|.|..||.|.||.|:.|.|:.             |.|..|...|.|:  ||:        
  Fly    84 VAETTGVYTACFGNQFSAFSHKIVYV-------------DFQVGEEPALPGV--DEH-------- 125

  Fly   163 MDFIGRIRLQLTKARQ-----LQDVL------RSHEARDRNLAESNFQKVNHWSMVQISAMIGVG 216
                ..:..|:..:.|     |.|:|      |..||:.|..||...|:|..||.::.:|:|.:|
  Fly   126 ----ATVLTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIG 186

  Fly   217 LIQVFMLRSIF 227
            |:|:.:||:.|
  Fly   187 LVQIMVLRNFF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 61/204 (30%)
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 61/204 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454845
Domainoid 1 1.000 62 1.000 Domainoid score I2479
eggNOG 1 0.900 - - E1_KOG1693
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.