DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and CHOp24

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster


Alignment Length:235 Identity:57/235 - (24%)
Similarity:92/235 - (39%) Gaps:60/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFTLL 77
            :||.:.:||:..:.:.|:    .|.|||...||.:.:|..|......::|||||..|:||..:  
  Fly     8 VLLLVGSLLILCRTSHAF----IVSVDAHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKIS-- 66

  Fly    78 DPIGLVIVSDFKKPENVHRHEVAKE------------GDYRFCFDNSFSMFNRKTVFFELIV--- 127
                        .|:|...||..||            |.|..||:|..|....|.|.|.:.|   
  Fly    67 ------------GPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDA 119

  Fly   128 -ER----EGEELQGDTQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHE 187
             :|    .|||..|.|:                      :.|.|..:...||..:..|:.:...:
  Fly   120 PQRAPGAPGEEEVGHTK----------------------LEDMIRELSGTLTSVKHEQEYMHVRD 162

  Fly   188 ARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            ...|::.|:...:|..||..:...::.:.:.||:.|:..|
  Fly   163 KIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKRFF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 51/213 (24%)
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 53/219 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.