DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and Tmed4

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_006251506.1 Gene:Tmed4 / 305502 RGDID:1306319 Length:227 Species:Rattus norvegicus


Alignment Length:239 Identity:57/239 - (23%)
Similarity:97/239 - (40%) Gaps:46/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GMPGLVLL-LSIAALLLGVQDAEAYDKEMTVYVDAGKTE--CLYHSVRQGETI----------DF 58
            ||...||| |::.|  .|.:.         :|...|:||  |....: ..||:          |.
  Rat    11 GMVRFVLLVLTVCA--AGARG---------LYFHIGETEKRCFIEEI-PDETMVIGNYRTQMWDK 63

  Fly    59 EYQVIDGGHGDLDISFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNS---FSMF--NR 118
            :.:|.......|.:...:.||.|.|::|.....|..........||::.|..::   .::|  .:
  Rat    64 QKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGK 128

  Fly   119 KTVFFELIVEREGEELQGDTQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVL 183
            ..|..::.|   ||......:....|:||.|      .::.:.::|       |:.:.::.||..
  Rat   129 LRVHLDIQV---GEHANNYPEIAAKDKLTEL------QLRARQLLD-------QVEQIQKEQDYQ 177

  Fly   184 RSHEARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            |..|.|.|..:||..|:|..||:.|...:|..|:.|:..|:|.|
  Rat   178 RYREERFRLTSESTNQRVLWWSIAQTVILILTGIWQMRHLKSFF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 48/210 (23%)
Tmed4XP_006251506.1 EMP24_GP25L 29..222 CDD:279450 49/219 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.