DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and Tmed5

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001007620.1 Gene:Tmed5 / 289883 RGDID:1359437 Length:229 Species:Rattus norvegicus


Alignment Length:225 Identity:90/225 - (40%)
Similarity:139/225 - (61%) Gaps:9/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IWLGMPGLVLLLSIAALLLGVQD-AEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGH 67
            :||..|.|:|....|.||.|... ..:.|.:.|..:.||:.||.|..:....:::.||||:||  
  Rat     5 MWLPFPMLLLSALPATLLSGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEIEYQVLDG-- 67

  Fly    68 GDLDISFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGE 132
            |:|||.|.|..|.|..:|.:.:|.:.||..| .::|||.|||||:||..:.|.:|||||::..||
  Rat    68 GELDIDFHLASPEGRTLVFEQRKSDGVHTVE-TEDGDYMFCFDNTFSTISEKVIFFELILDNMGE 131

  Fly   133 ELQGDTQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESN 197
            |::|...|.:.     ::..:..:||::||::.|..|:.:|:|:..:|.:||:.||||||:.|||
  Rat   132 EVEGQEDWKKY-----ITNTDVLEMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESN 191

  Fly   198 FQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            |.:||.||:|.:..|:.|..|||:.|:|:|
  Rat   192 FDRVNFWSVVNLMVMVVVSAIQVYTLKSLF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 79/193 (41%)
Tmed5NP_001007620.1 EMP24_GP25L 35..222 CDD:279450 80/195 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 161 1.000 Domainoid score I3926
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4996
Inparanoid 1 1.050 172 1.000 Inparanoid score I4006
OMA 1 1.010 - - QHG49398
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm9115
orthoMCL 1 0.900 - - OOG6_108563
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1510
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.