DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and tmed-13

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_741426.2 Gene:tmed-13 / 260287 WormBaseID:WBGene00022255 Length:222 Species:Caenorhabditis elegans


Alignment Length:240 Identity:51/240 - (21%)
Similarity:101/240 - (42%) Gaps:47/240 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLVLLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGET-IDFEYQVIDGGHGDLDIS 73
            |.||:.::..:.     ::|| .:|...::..| ||::..|.|..: :|.....:   :.:..:|
 Worm     9 GFVLVSTVDGIF-----SDAY-VDMRFLLETEK-ECVFFEVHQPHSQMDISVSAL---NSEYHLS 63

  Fly    74 FTLLDPIGLVIVSDFKKPENVHR-----------HEVAKEGDYRFCFDNSFSMFNRKTVFFELIV 127
            ..|.:|.|   .|.||.|.|...           ||:   ||::.|..   |...|::|...||:
 Worm    64 VELFNPSG---SSTFKTPNNGKHYFKFPEVDGTFHEI---GDFQLCVS---SRQVRQSVQVNLII 119

  Fly   128 ---EREGEELQGDTQWNEADELTGLSRDEYYD-----MKVQDIMDFIGRIRLQLTKARQLQDVLR 184
               |:....:      :.|..|..:..:..||     :|..:.:.....::|::.|..|.:... 
 Worm   120 VIHEKNANNI------DVASNLKRIQTNPSYDETKMTLKTFEQITLNIDVKLKIMKTEQAKRAF- 177

  Fly   185 SHEARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIFAT 229
             .|..||...|:.|:.:|.|.::::..:..:...||..:|::.:|
 Worm   178 -VEKIDRQHIETAFEMINFWHIMRVCLVFFIAGFQVHAIRTLLST 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 45/213 (21%)
tmed-13NP_741426.2 EMP24_GP25L 26..220 CDD:366467 45/214 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.