DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and C26C6.9

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001021011.1 Gene:C26C6.9 / 259317 WormBaseID:WBGene00007743 Length:217 Species:Caenorhabditis elegans


Alignment Length:241 Identity:47/241 - (19%)
Similarity:74/241 - (30%) Gaps:69/241 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLSIAALLL--GVQDAEAYDKEMTVYVDAGKTECLYHSVRQG--------ETIDFEYQVIDGGH 67
            ||.|..||..  .:.|.....:.:| :....:..|.|..:..|        .|.|..|       
 Worm    11 LLASTDALTTKSSINDDSQIGRILT-FESESQLSCYYEPLETGMILNIGMRPTFDTVY------- 67

  Fly    68 GDLDISFTLLDPIGLVIVSDFKKPE-NVH-RHEVAKEGDYRFC--------------FDNSFSMF 116
               .:.|.:..|.|  ..||:...: :.| .|...:.|.|..|              |.|...|.
 Worm    68 ---PMQFRVTSPSG--DFSDWASGDGDAHMEHNTTENGPYEICVYTRRPMKINLYLQFYNPEKME 127

  Fly   117 NRKTVFFELIVEREGEELQGDTQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQD 181
            |....||      ...::..|.| |.....|......||.:|..:.|                  
 Worm   128 NSLKTFF------AHHQISKDIQ-NSIMASTHRIYKIYYHLKFYNQM------------------ 167

  Fly   182 VLRSHEARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
                 ..||..|...|.:.:.::::|.....|.:.:.||:.:|.:|
 Worm   168 -----VVRDEALQLQNSEFIQNYNIVFCIVAIIITISQVYYVRKLF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 40/217 (18%)
C26C6.9NP_001021011.1 EMP24_GP25L 34..209 CDD:366467 41/218 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.