DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and Tmed7

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001099228.1 Gene:Tmed7 / 252889 RGDID:727954 Length:226 Species:Rattus norvegicus


Alignment Length:225 Identity:67/225 - (29%)
Similarity:103/225 - (45%) Gaps:20/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLGMPGLVLLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGD 69
            |....|......:|.|||.:....:...|:|..:.....:|.|..:.||.....|:|||.|||.|
  Rat    10 WAAAAGRWSCRLLALLLLLLLPGPSGGSEITFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYD 74

  Fly    70 LDISFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEEL 134
            :|.  .|.||.|.|:..:.||..:......:|.|.|:|||.|.||.|..|||:|:..|   ||:.
  Rat    75 VDC--RLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQV---GEDP 134

  Fly   135 QGDTQWNEADELTGL-SRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNF 198
            ......|....||.: |........::.::|:....||:              ||:.|:.||...
  Rat   135 PLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLR--------------EAQGRSRAEDLN 185

  Fly   199 QKVNHWSMVQISAMIGVGLIQVFMLRSIFA 228
            .:|.:||:.:...::.|.:.|||:|:|.|:
  Rat   186 TRVAYWSVGEALILLVVSIGQVFLLKSFFS 215

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 60/194 (31%)
Tmed7NP_001099228.1 EMP24_GP25L 38..214 CDD:395878 60/194 (31%)
COPI vesicle coat-binding. /evidence=ECO:0000255 213..226 1/3 (33%)