DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and TMED3

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_031390.1 Gene:TMED3 / 23423 HGNCID:28889 Length:217 Species:Homo sapiens


Alignment Length:213 Identity:65/213 - (30%)
Similarity:100/213 - (46%) Gaps:18/213 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SIAALLLGVQDAE-AYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFTLLDP 79
            |:..|||.::.|| ....|:|..:.....:|.:..|.||.....:||||.|||.|:|.  .:.||
Human    10 SVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDC--YVEDP 72

  Fly    80 IGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEELQGDTQWNEAD 144
            .|..|..:.||..:...:....:|.|:|||.|.||.|:.|||:|:..|..|...|.     :..:
Human    73 QGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPPILP-----DMGN 132

  Fly   145 ELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKVNHWSMVQI 209
            .:|.|::.|...:.:.:          .|......|...|..||:||..||....:|::||:.:.
Human   133 RVTALTQMESACVTIHE----------ALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGET 187

  Fly   210 SAMIGVGLIQVFMLRSIF 227
            .|:..|...||.:|:|.|
Human   188 IALFVVSFSQVLLLKSFF 205

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 58/193 (30%)
TMED3NP_031390.1 EMP24_GP25L 28..205 CDD:307313 58/193 (30%)
COPI vesicle coat-binding. /evidence=ECO:0000255 204..217 1/2 (50%)