DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and sel-9

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001370673.1 Gene:sel-9 / 179213 WormBaseID:WBGene00004766 Length:203 Species:Caenorhabditis elegans


Alignment Length:220 Identity:45/220 - (20%)
Similarity:92/220 - (41%) Gaps:23/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MPGLVLLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDI 72
            |..|..:|::    |.|..|.:|    .::|||.:.:|.:..:..|..:...::|.:||..|:|:
 Worm     1 MNSLTWILAV----LFVTPAASY----FIHVDANEEQCFFDRLTSGTKMGLMFEVAEGGFLDIDV 57

  Fly    73 SFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEELQGD 137
            ..|  .|....|....::...........:|.|.:||.|..|....|.|.|.:.:....::..| 
 Worm    58 KIT--GPDNKEIYKGERESSGKFTFAAHMDGVYTYCFGNKMSTMTPKAVMFTVEITEPHQQAPG- 119

  Fly   138 TQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKVN 202
                     ...::|...:.|::::   :..:...|...:..|:.:...|...||:.|:...:|.
 Worm   120 ---------AAANQDAADNAKLEEM---VRELSSALMSVKHEQEYMEVRERVHRNINENTNSRVV 172

  Fly   203 HWSMVQISAMIGVGLIQVFMLRSIF 227
            .|:..:...::|:.:.|:|.|:..|
 Worm   173 MWAAFEAFVLVGMTVGQIFYLKRFF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 37/193 (19%)
sel-9NP_001370673.1 EMP24_GP25L 21..198 CDD:395878 38/192 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.