DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and tmed-3

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_491892.1 Gene:tmed-3 / 172372 WormBaseID:WBGene00019003 Length:203 Species:Caenorhabditis elegans


Alignment Length:230 Identity:62/230 - (26%)
Similarity:100/230 - (43%) Gaps:52/230 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VLLLSI-AALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFT 75
            |::.|| .||.|.:        |:|..:.....:|.|..:::.....||:||:.|||.|:|:  .
 Worm     5 VIVSSILVALGLSI--------ELTFELPDNANQCFYEDLKKDVDTVFEFQVVTGGHYDVDL--I 59

  Fly    76 LLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEELQGDTQW 140
            :.||.|.|:..|.||..:....:...||.|:.||.|.||.|:.|.|:.:               |
 Worm    60 IEDPNGKVLYKDTKKQYDSINFKAEVEGTYKACFSNEFSTFSHKIVYMD---------------W 109

  Fly   141 NEADE----------LTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSH---EARDRN 192
            ...|:          ...:::.|.|.:.:.|             |.|.:.|....|   ||..|.
 Worm   110 QFGDQNALHAAVTQGAHAMTQLENYAVAIGD-------------KLRTIDDYQTHHRLREATGRK 161

  Fly   193 LAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            .||...::|..||:.|.:.::.:|:.|||:|:|.|
 Worm   162 RAEELNERVMIWSLGQSAVVVFIGIGQVFLLKSFF 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 55/206 (27%)
tmed-3NP_491892.1 EMP24_GP25L 19..197 CDD:366467 56/208 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.