DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and AgaP_AGAP004743

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_318076.3 Gene:AgaP_AGAP004743 / 1278482 VectorBaseID:AGAP004743 Length:205 Species:Anopheles gambiae


Alignment Length:217 Identity:51/217 - (23%)
Similarity:87/217 - (40%) Gaps:20/217 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFT 75
            |:|...:..|.|.|.....|    .:.||....||.:.....|..:...::.::||.  |||...
Mosquito     3 LLLNFLVCFLFLCVVPIRGY----FITVDPHSEECFFDRAEAGTKLGLMFETVEGGF--LDIEVR 61

  Fly    76 LLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEELQGDTQW 140
            :..|...||....|:....:.....:.|.|.:||.|..|....|.|.|.:.:   ||..:|    
Mosquito    62 ISGPDQKVIYQGEKESSGKYTFSAYETGIYHYCFSNKMSTLTPKVVMFSMEI---GEAPKG---- 119

  Fly   141 NEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKVNHWS 205
                .:..::..|....|::|:   |..:...||..:..||.:...:...|::.||...:|..||
Mosquito   120 ----TVGAVNEGEAGHTKLEDM---IRELSGTLTSIKHEQDYMHVRDRIHRSINESTNSRVVMWS 177

  Fly   206 MVQISAMIGVGLIQVFMLRSIF 227
            ..:...:|.:.:.||:.|:..|
Mosquito   178 FFEAIVLIVMTVGQVYYLKRFF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 44/193 (23%)
AgaP_AGAP004743XP_318076.3 EMP24_GP25L 21..200 CDD:279450 46/199 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.