DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and TMED2

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001308374.1 Gene:TMED2 / 10959 HGNCID:16996 Length:208 Species:Homo sapiens


Alignment Length:221 Identity:50/221 - (22%)
Similarity:92/221 - (41%) Gaps:31/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFTLL 77
            ||:.:||||..|..       ..|.:||...||.:..|..|..:...::|.:||..|:|:..|..
Human     7 LLVLLAALLATVSG-------YFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGP 64

  Fly    78 DPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVER--EGEELQ----G 136
            |..|  |....::....:......:|.|:|||.|..|....|.|.|.:.:..  :|::::    |
Human    65 DNKG--IYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEGGG 127

  Fly   137 DTQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKV 201
            ||                :|.....:.:.|..:.:.:|..:..|:.:...|...|.:.::...:|
Human   128 DT----------------WDAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRV 176

  Fly   202 NHWSMVQISAMIGVGLIQVFMLRSIF 227
            ..||..:...::.:.|.|::.|:..|
Human   177 VLWSFFEALVLVAMTLGQIYYLKRFF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 42/199 (21%)
TMED2NP_001308374.1 EMP24_GP25L 23..203 CDD:366467 43/198 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.