DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and tmed6

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_005163268.1 Gene:tmed6 / 101884766 ZFINID:ZDB-GENE-131121-182 Length:240 Species:Danio rerio


Alignment Length:218 Identity:53/218 - (24%)
Similarity:96/218 - (44%) Gaps:16/218 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGE--TIDFEYQVIDGGHGDLDISFTLL 77
            ||...||.|   ::.||  .::.:.|...:|.:|....||  .::|..|::.|...|..:|..:.
Zfish    24 LSDQELLWG---SDQYD--FSIMLRAADLQCFWHFAHYGEHFYLNFMVQLVTGVALDRHLSVMVN 83

  Fly    78 DPIGLVI--VSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEELQGDTQW 140
            .|.||::  |.|   ........|.:.|.|:.||.|..:.|....||.:..|..:|:|   :.:.
Zfish    84 APSGLIVGKVDD---ASGQIAFSVKETGFYQMCFSNFHNRFGSMQVFLDFGVYYDGQE---NAEK 142

  Fly   141 NEADELTGLSRD-EYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKVNHW 204
            .:.||......| :..:..:..|.:..||::..:....:..:..|.....|..|.:||...::.|
Zfish   143 RKEDEKKRKEEDLKQINSTLSVIEESSGRLQRFVFHMWRHYNYERMRRGADFYLLQSNSSYISSW 207

  Fly   205 SMVQISAMIGVGLIQVFMLRSIF 227
            |..|...:|..|::|::.:|.:|
Zfish   208 SAAQSLMIISAGVLQLWGIRRLF 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 45/198 (23%)
tmed6XP_005163268.1 EMP24_GP25L 37..231 CDD:279450 47/202 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.