DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and si:ch211-255i20.3

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_003199913.2 Gene:si:ch211-255i20.3 / 100535182 ZFINID:ZDB-GENE-141216-113 Length:220 Species:Danio rerio


Alignment Length:247 Identity:53/247 - (21%)
Similarity:89/247 - (36%) Gaps:75/247 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MPGLVLLLSIAALLLGVQDAEAYDKEMTV-----------YVDAGKTECLYHSVRQGETI---DF 58
            :...|:|.|.....||.|:.:...:|:.|           |.|..|..   ::.:.|.|:   |.
Zfish    16 LASFVILASAMYFDLGEQEEKCIIEEIPVDTLVTGVFRLEYWDENKKS---NTPQLGLTVTVRDP 77

  Fly    59 EYQVI----DGGHGDLDISFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRK 119
            :::|:    .|.:|    .||...|                     ..|.:..|..::.:.|   
Zfish    78 QHEVVLLKRFGRYG----KFTFTSP---------------------ASGQHFLCMQSNSTRF--- 114

  Fly   120 TVFFELIVEREGEELQG--DTQWNE--ADELTGLSRD-----EYYDMKVQDIMDFIGRIRLQLTK 175
            :||       .|:.|:.  |.|..|  .|.....::|     ||....:.|.|.:|.|       
Zfish   115 SVF-------AGDRLKVHLDVQMGEHTIDPNAAKTKDTIKAMEYNLQHLIDQMRYISR------- 165

  Fly   176 ARQLQDVLRSHEARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
               .||..|..|.:.|.::|.....|..|:::|.|.::.||..|:..|:..|
Zfish   166 ---QQDFQREREEKFRQMSEETNGNVLWWAIIQTSILLSVGFWQMKNLKDFF 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 46/220 (21%)
si:ch211-255i20.3XP_003199913.2 EMP24_GP25L 25..214 CDD:279450 49/236 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585524
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.