DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and gp25l

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_002937324.3 Gene:gp25l / 100489853 XenbaseID:XB-GENE-955109 Length:218 Species:Xenopus tropicalis


Alignment Length:202 Identity:38/202 - (18%)
Similarity:79/202 - (39%) Gaps:32/202 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 MTVYVDAGKTECLYHSVRQGETIDFEYQV----------IDGGHGDLDISFTLLDPIGLVIVSDF 88
            |..:|...:.:||...:.....:...|::          :....| |.:..|:..|.|.|::|..
 Frog    21 MYFHVAEKEEKCLIEDLPSETLVTGRYKIQKWDLKEHDFLPSAPG-LGMVVTVTAPNGEVLLSKL 84

  Fly    89 KKPENVHRHEVAKEGDYRFCF-DNSFSMF----NRKTVFFELIVEREGEELQGDTQWNEADELTG 148
            ..|:..........|::..|. .||.::.    |:..:.|::   :.||        |..|....
 Frog    85 YGPDGKFTFTSHSPGEHTICLQSNSTNLIAFVSNKLRIHFDI---QSGE--------NPLDFHII 138

  Fly   149 LSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKVNHWSMVQISAMI 213
            .::|     ||:::...:..:|.::....:.|:..|..|...|..:|.....|..|:::|.:.:.
 Frog   139 NAKD-----KVKEVTYGLEHLRGEINHIIKQQEYQREREEHYRGKSEETNNNVLWWAIIQTAILT 198

  Fly   214 GVGLIQV 220
            .||:.|:
 Frog   199 SVGIWQI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 38/202 (19%)
gp25lXP_002937324.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.