DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and TMED7-TICAM2

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001157940.1 Gene:TMED7-TICAM2 / 100302736 HGNCID:33945 Length:404 Species:Homo sapiens


Alignment Length:209 Identity:62/209 - (29%)
Similarity:91/209 - (43%) Gaps:26/209 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLGMPGL--VLLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGH 67
            |..:.|.  ..||::..|:.|...|    .|:|..:.....:|.|..:.||.....|:|||.|||
Human    10 WAAVAGRWGCRLLALLLLVPGPGGA----SEITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGH 70

  Fly    68 GDLDISFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGE 132
            .|:|.  .|.||.|.|:..:.||..:......:|.|.|:|||.|.||.|..|||:|:..|   ||
Human    71 YDVDC--RLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQV---GE 130

  Fly   133 ELQGDTQWNEADELTGL-SRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAES 196
            :.......|....||.: |........::.::|:....||:              ||:.|:.||.
Human   131 DPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLR--------------EAQGRSRAED 181

  Fly   197 NFQKVNHWSMVQIS 210
            ...:|.:|..|..|
Human   182 LNTRVAYWHSVDTS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 55/179 (31%)
TMED7-TICAM2NP_001157940.1 EMP24_GP25L 36..189 CDD:279450 52/171 (30%)
TIR_2 250..>341 CDD:304906
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.