DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B18 and AT2G02050

DIOPT Version :9

Sequence 1:NP_001285259.1 Gene:ND-B18 / 32434 FlyBaseID:FBgn0030605 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_565280.1 Gene:AT2G02050 / 814736 AraportID:AT2G02050 Length:103 Species:Arabidopsis thaliana


Alignment Length:84 Identity:37/84 - (44%)
Similarity:47/84 - (55%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MIATQEEMESAKLPLEFRDYCAHLAIAYQACRSDTFPFVYKCAHQKHEYLTCEYE---DYVLRMK 98
            ||||||||.:||:.|..||.||||.|....||...|...:||..::|.|..||||   :.:|.||
plant    10 MIATQEEMSAAKIALGSRDMCAHLLIPLNKCRQAEFYLPWKCEDERHVYEKCEYELVMERMLAMK 74

  Fly    99 EFERERRLLERQKRLNKAA 117
            :...|..|.::.|....||
plant    75 KIREEEALAKQNKLQGNAA 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B18NP_001285259.1 NDUF_B7 38..100 CDD:283359 31/64 (48%)
AT2G02050NP_565280.1 NDUF_B7 12..70 CDD:398999 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3832
eggNOG 1 0.900 - - E1_KOG3468
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2482
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1570033at2759
OrthoFinder 1 1.000 - - FOG0006528
OrthoInspector 1 1.000 - - oto4210
orthoMCL 1 0.900 - - OOG6_103294
Panther 1 1.100 - - LDO PTHR20900
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4760
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.