DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B18 and ndufb7

DIOPT Version :9

Sequence 1:NP_001285259.1 Gene:ND-B18 / 32434 FlyBaseID:FBgn0030605 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001017236.1 Gene:ndufb7 / 549990 XenbaseID:XB-GENE-1005640 Length:116 Species:Xenopus tropicalis


Alignment Length:107 Identity:49/107 - (45%)
Similarity:70/107 - (65%) Gaps:5/107 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ALTHYMKPDVMPGPDVVPTFDPLLGFKSRKERVMIATQEEMESAKLPLEFRDYCAHLAIAYQACR 68
            |..::.:|:  |.|:.:|. .|..|.  ..||||:|:||:|..|::|||.||||||..|....|:
 Frog     6 ARRYWGEPE--PDPNNMPA-SPEAGV--LPERVMVASQEQMNLAQVPLEQRDYCAHHLIELMKCK 65

  Fly    69 SDTFPFVYKCAHQKHEYLTCEYEDYVLRMKEFERERRLLERQ 110
            .|.:|....|.|::||:..|::||||.|||::|||||||.:|
 Frog    66 RDMWPNFLACKHERHEWDLCQHEDYVQRMKQYERERRLLVQQ 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B18NP_001285259.1 NDUF_B7 38..100 CDD:283359 30/61 (49%)
ndufb7NP_001017236.1 NDUF_B7 35..95 CDD:368555 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9114
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3059
Inparanoid 1 1.050 95 1.000 Inparanoid score I4923
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1570033at2759
OrthoFinder 1 1.000 - - FOG0006528
OrthoInspector 1 1.000 - - oto105450
Panther 1 1.100 - - LDO PTHR20900
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2667
SonicParanoid 1 1.000 - - X4760
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.