DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B18 and ndufb7

DIOPT Version :9

Sequence 1:NP_001285259.1 Gene:ND-B18 / 32434 FlyBaseID:FBgn0030605 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_957142.1 Gene:ndufb7 / 393821 ZFINID:ZDB-GENE-040426-1886 Length:120 Species:Danio rerio


Alignment Length:106 Identity:57/106 - (53%)
Similarity:72/106 - (67%) Gaps:0/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DVMPGPDVVPTFDPLLGFKSRKERVMIATQEEMESAKLPLEFRDYCAHLAIAYQACRSDTFPFVY 76
            |..|.|:....:||.|||..||||||:||||:|..|.||::.||||||..|....||.|.||...
Zfish    14 DATPEPNKPSQYDPHLGFGERKERVMVATQEQMNLAMLPVDQRDYCAHHLIKLMKCRRDMFPNYM 78

  Fly    77 KCAHQKHEYLTCEYEDYVLRMKEFERERRLLERQKRLNKAA 117
            .|.||||::..|:::|||:||||:||||||..|:||:...|
Zfish    79 ACDHQKHDWEYCQHQDYVMRMKEYERERRLNLRKKRIEANA 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B18NP_001285259.1 NDUF_B7 38..100 CDD:283359 32/61 (52%)
ndufb7NP_957142.1 NDUF_B7 40..102 CDD:283359 32/61 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585305
Domainoid 1 1.000 78 1.000 Domainoid score I8735
eggNOG 1 0.900 - - E1_KOG3468
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3059
Inparanoid 1 1.050 121 1.000 Inparanoid score I4745
OMA 1 1.010 - - QHG45746
OrthoDB 1 1.010 - - D1570033at2759
OrthoFinder 1 1.000 - - FOG0006528
OrthoInspector 1 1.000 - - oto40387
orthoMCL 1 0.900 - - OOG6_103294
Panther 1 1.100 - - LDO PTHR20900
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2667
SonicParanoid 1 1.000 - - X4760
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.