DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B18 and Ndufb7

DIOPT Version :9

Sequence 1:NP_001285259.1 Gene:ND-B18 / 32434 FlyBaseID:FBgn0030605 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001101912.1 Gene:Ndufb7 / 361385 RGDID:1308550 Length:137 Species:Rattus norvegicus


Alignment Length:114 Identity:59/114 - (51%)
Similarity:76/114 - (66%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNALT--HYMKPDVMPGPDVVPTFDPLLGFKSRKERVMIATQEEMESAKLPLEFRDYCAHLAIA 63
            ||..||  :.....|.|.|:.:|:|.|..|...||||||:|||:||..|:|.|:.||||||..|.
  Rat     1 MGAHLTRRYLWDASVEPDPEKMPSFPPNYGLPERKERVMVATQQEMMDAQLTLQQRDYCAHYLIR 65

  Fly    64 YQACRSDTFPFVYKCAHQKHEYLTCEYEDYVLRMKEFERERRLLERQKR 112
            ...|:.|:||....|.|::|::..||::|||.||||||||||||.|:||
  Rat    66 LLKCKRDSFPNFVACKHEQHDWDYCEHQDYVKRMKEFERERRLLRRKKR 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B18NP_001285259.1 NDUF_B7 38..100 CDD:283359 30/61 (49%)
Ndufb7NP_001101912.1 NDUF_B7 40..102 CDD:283359 30/61 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344239
Domainoid 1 1.000 75 1.000 Domainoid score I8879
eggNOG 1 0.900 - - E1_KOG3468
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3059
Inparanoid 1 1.050 119 1.000 Inparanoid score I4695
OMA 1 1.010 - - QHG45746
OrthoDB 1 1.010 - - D1570033at2759
OrthoFinder 1 1.000 - - FOG0006528
OrthoInspector 1 1.000 - - oto98754
orthoMCL 1 0.900 - - OOG6_103294
Panther 1 1.100 - - LDO PTHR20900
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4760
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.