DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B18 and D2030.4

DIOPT Version :9

Sequence 1:NP_001285259.1 Gene:ND-B18 / 32434 FlyBaseID:FBgn0030605 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_492119.1 Gene:D2030.4 / 172513 WormBaseID:WBGene00008414 Length:123 Species:Caenorhabditis elegans


Alignment Length:123 Identity:55/123 - (44%)
Similarity:73/123 - (59%) Gaps:6/123 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNALTHYMK----PDVMPGPDVVPTFDPLLGF-KSRKERVMIATQEEMESAKLPLEFRDYCAHL 60
            ||..|:..::    |:..|..|..|||||..|| :.||.|.|.||.||||..||....||||||.
 Worm     1 MGTKLSVSLEGASTPETAPRVDRPPTFDPQYGFERPRKVREMKATWEEMEQWKLKPAQRDYCAHH 65

  Fly    61 AIAYQACRSDTFPFV-YKCAHQKHEYLTCEYEDYVLRMKEFERERRLLERQKRLNKAA 117
            .|:...|::...||. :.|..::..:..|||:|:::|:||||||||||:||.|....|
 Worm    66 LISLMKCQTQNAPFAGHACDGERGAWDKCEYDDHIMRIKEFERERRLLQRQARKEATA 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B18NP_001285259.1 NDUF_B7 38..100 CDD:283359 25/62 (40%)
D2030.4NP_492119.1 NDUF_B7 43..106 CDD:283359 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161687
Domainoid 1 1.000 57 1.000 Domainoid score I7280
eggNOG 1 0.900 - - E1_KOG3468
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I3616
Isobase 1 0.950 - 0 Normalized mean entropy S3726
OMA 1 1.010 - - QHG45746
OrthoDB 1 1.010 - - D1570033at2759
OrthoFinder 1 1.000 - - FOG0006528
OrthoInspector 1 1.000 - - oto18985
orthoMCL 1 0.900 - - OOG6_103294
Panther 1 1.100 - - LDO PTHR20900
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2667
SonicParanoid 1 1.000 - - X4760
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.