DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eag and PLPB

DIOPT Version :9

Sequence 1:NP_001036275.1 Gene:eag / 32428 FlyBaseID:FBgn0000535 Length:1270 Species:Drosophila melanogaster
Sequence 2:NP_565288.1 Gene:PLPB / 814800 AraportID:AT2G02710 Length:399 Species:Arabidopsis thaliana


Alignment Length:118 Identity:31/118 - (26%)
Similarity:55/118 - (46%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRYVCGFMYGELTDKETVGRLEYTLENQQ 94
            ||:|.|..:.|.||:|.:::|..::||.|.||:.::||    |:.|..||...:..::..:...|
plant   260 SFVLTNPCLPDMPIIYASDAFLTLTGYKRQEVLGQNCR----FLSGVDTDSSVLYEMKECILKGQ 320

  Fly    95 QDQFEILLYKKNNLQCGCALSQFGKAQTQETPLWLLLQVAPIRNERDLVVLFL 147
            ....:||.|..               :..::..|.||.::|:||.......|:
plant   321 SCTVQILNYSN---------------RKDKSSFWNLLHISPVRNASGKTAYFV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eagNP_001036275.1 PAS_9 28..155 CDD:290162 31/118 (26%)
PAS 40..153 CDD:238075 27/108 (25%)
Ion_trans 254..499 CDD:278921
Ion_trans_2 <440..494 CDD:285168
Crp 565..>702 CDD:223736
CAP_ED 571..682 CDD:237999
PLPBNP_565288.1 PRK13558 <28..>171 CDD:237426
PRK13559 256..>379 CDD:237427 31/118 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3140
eggNOG 1 0.900 - - E1_COG2202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.