DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eag and Ih

DIOPT Version :9

Sequence 1:NP_001036275.1 Gene:eag / 32428 FlyBaseID:FBgn0000535 Length:1270 Species:Drosophila melanogaster
Sequence 2:NP_001033948.1 Gene:Ih / 36589 FlyBaseID:FBgn0263397 Length:1327 Species:Drosophila melanogaster


Alignment Length:688 Identity:167/688 - (24%)
Similarity:271/688 - (39%) Gaps:167/688 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 NERDLVVLFLLTFRDITALKQPIDSE--------------DTKGVLGLSKFAKLARSVTRSRQFS 188
            |:.||.:.|..|..|  :|....|.|              |...:.|..|...:......|.:.|
  Fly   639 NDNDLRISFENTCTD--SLVTAFDDEALLICDQGTEMVHFDDVSLYGTPKEEPMPNIPIVSEKVS 701

  Fly   189 AH-----LPTLKDPTKQSNLAHMM--SLSADIMPQYRQEAPKTPPHILLHYC-AFKAIWDWVILC 245
            |:     |.:...|| .:.||..:  |..|.:..:.||   ||..|.::|.| :|:..||..:|.
  Fly   702 ANFLKSQLQSWFQPT-DNRLAMKLFGSRKALVKERIRQ---KTSGHWVIHPCSSFRFYWDLCMLL 762

  Fly   246 LTFYTAIMVPYNVAFKNKTSEDVSL--LVVDSIVDVIFFIDIVLNFHTTFVGPGG--EVVSDPKV 306
            |.....|::|..::|.|   :|:|.  :..:.:.|.||.||||:||.|..:....  :|:.|||:
  Fly   763 LLVANLIILPVAISFFN---DDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKL 824

  Fly   307 IRMNYLKSWFIIDLLSCLPYD----VFNAFDRDEDGIGS--------------LFSALKVVRLLR 353
            |..:||::||.:||:|.:|.|    :||...:.:|...|              |...|.:|||||
  Fly   825 IAKHYLRTWFFLDLISSIPLDYIFLIFNQIMKLQDFSDSFQILHAGRALRILRLAKLLSLVRLLR 889

  Fly   354 LGRVVRKLDRYLE-------------------------YGAAMLIL--------------LLCFY 379
            |.|:||.:.::.|                         ...:.|||              |:|..
  Fly   890 LSRLVRYVSQWEEVYILQNLQKKSADRRGRMNRKDKDGLTKSNLILKFLNMASVFMRIFNLICMM 954

  Fly   380 MLVAHWLACI--------------WYSIGRSDADNGIQYS-WLWKLANVTQSPYSYIWSNDTGPE 429
            :|:.||..|:              |.||      |.:|.| ||          ..|.|       
  Fly   955 LLIGHWSGCLQFLVPMLQGFPSNSWVSI------NELQESYWL----------EQYSW------- 996

  Fly   430 LVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAALLYATIFGHVTTIIQQ 494
                         ||:..|:.|..:|:|....::..:...|:..||..|..||...||.|.:||.
  Fly   997 -------------ALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQS 1048

  Fly   495 MTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTEKVLNYCPKDMKADICV 559
            :.|:..:|.:.:..|.|:|...::|:.:.:|:.:|....: ..|..|.|.:|....:.::.|:..
  Fly  1049 LDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRY-QGKFFDEELILGELSEKLREDVIN 1112

  Fly   560 HLNRKVFNEHPAFRLASDGCLRALAMHFMMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQ-DDE 623
            :..|.:....|.|..|....:..:..........|||::...|.....:.||..|.::::. :.|
  Fly  1113 YNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGE 1177

  Fly   624 VVAILGKGDVFGDQFWKDSAVGQSAANVRALTYCDLHAIKRDKLLEVLDFYSAFANSFARNLVLT 688
            |...|..|..||:.....:|  :..|:|||.|||:|.::..|....|||.|.             
  Fly  1178 VATSLSDGSYFGEICLLTNA--RRVASVRAETYCNLFSLSVDHFNCVLDQYP------------- 1227

  Fly   689 YNLRHRLIFRKVADVKREKELAERRKNEPQLPQNQDHL 726
                   :.||..:....:.|.:..||...:.|..:.|
  Fly  1228 -------LMRKTMETVAAERLNKIGKNPNIMHQKDEQL 1258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eagNP_001036275.1 PAS_9 28..155 CDD:290162 6/16 (38%)
PAS 40..153 CDD:238075 5/14 (36%)
Ion_trans 254..499 CDD:278921 82/320 (26%)
Ion_trans_2 <440..494 CDD:285168 16/53 (30%)
Crp 565..>702 CDD:223736 32/137 (23%)
CAP_ED 571..682 CDD:237999 29/111 (26%)
IhNP_001033948.1 Ion_trans_N 709..751 CDD:285597 14/45 (31%)
Ion_trans 771..1054 CDD:278921 82/321 (26%)
Crp 1118..>1241 CDD:223736 32/144 (22%)
CAP_ED 1124..1233 CDD:237999 31/130 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm987
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.