DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdgy and CMR2

DIOPT Version :9

Sequence 1:NP_001188590.1 Gene:pdgy / 32426 FlyBaseID:FBgn0027601 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_014736.1 Gene:CMR2 / 854260 SGDID:S000005619 Length:1648 Species:Saccharomyces cerevisiae


Alignment Length:397 Identity:78/397 - (19%)
Similarity:147/397 - (37%) Gaps:125/397 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ATRSITTNRRQRTTSTASAQRERTQSVSETDKFLHYSPEDGYYKTSPFDPVTIPNVPLH------ 78
            :|.:..|.||:....|||.|.....|          |.|:|..|.:.::|: ||.:|.|      
Yeast    99 STSANNTPRRRSKRYTASLQSSLPGS----------SDENGSVKDAVYNPM-IPLLPRHTGAENT 152

  Fly    79 ---EYVWRD---------FKKWERRTAAVCVITDRQYTFAQMRDASAAFAVRLQTKFN---LQKP 128
               :....|         |:.::.:||.:.:.:..:.||... |.....|.|:..:.|   |.|.
Yeast   153 SSGDSAMTDSLPLILRGRFEHYDGQTAMISINSKGKETFITW-DKLYLKAERVAHELNKSHLYKM 216

  Fly   129 DVLAICL--PNLPEYPIATLGAIEAGLTVTTVN-PVYTPDEIARQLTFSGAKFLVGTVSGFATLS 190
            |.:.:..  .::.|:.||.||...:|:....|: ..|:..||...:..:.:||::          
Yeast   217 DKILLWYNKNDVIEFTIALLGCFISGMAAVPVSFETYSLREILEIIKVTNSKFVL---------- 271

  Fly   191 QASKLVGRQI----------PIAVVRTSAEEALPEGAIDFSELTSTQNVRYEDL----KAPKEAS 241
             .|....||:          .:.:|:...          |.::   :.|:.:||    ||.|.:.
Yeast   272 -ISNACHRQLDNLYSSSNHSKVKLVKNDV----------FQQI---KFVKTDDLGTYTKAKKTSP 322

  Fly   242 ADD---MVFLPFSSGTTGLPKGVMLSHNNITSNCEQV-----QASLP------------------ 280
            ..|   :.::.|:....|...||::.||.:.:..|.:     ..|:|                  
Yeast   323 TFDIPNISYIEFTRTPLGRLSGVVMKHNILINQFETMTKILNSRSMPHWKQKSQSIRKPFHKKIM 387

  Fly   281 --------LDLMGPQNT---LPGVLPFFHIY--GLTVVMLSKLGQGCRLATMPCFKPDDFMRSLD 332
                    |:.:.|..:   :.|||  |:::  .|.:.:.|.:.|          :|..:...:|
Yeast   388 ATNSRFVILNSLDPTRSTGLIMGVL--FNLFTGNLMISIDSSILQ----------RPGGYENIID 440

  Fly   333 KYQGSIL 339
            |::..||
Yeast   441 KFRADIL 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdgyNP_001188590.1 CaiC 77..595 CDD:223395 61/340 (18%)
Firefly_Luc_like 99..587 CDD:213279 56/300 (19%)
CMR2NP_014736.1 DMAP_binding 5..121 CDD:368923 8/21 (38%)
AFD_class_I 179..893 CDD:418409 57/306 (19%)
Dip2 1004..1626 CDD:341231
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.