DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdgy and DIP2B

DIOPT Version :9

Sequence 1:NP_001188590.1 Gene:pdgy / 32426 FlyBaseID:FBgn0027601 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_775873.2 Gene:DIP2B / 57609 HGNCID:29284 Length:1576 Species:Homo sapiens


Alignment Length:632 Identity:138/632 - (21%)
Similarity:229/632 - (36%) Gaps:171/632 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 HEYV-----WRD--------FKKWERRTAAVCVITDRQYTFAQMRDASAAFAVRLQTKFNLQKPD 129
            |:::     ||.        |.....:...||..     :..|:...:...|..|..|.:|...|
Human   988 HQFLAEILQWRAQATPDHVLFMLLNAKGTTVCTA-----SCLQLHKRAERIASVLGDKGHLNAGD 1047

  Fly   130 VLAICLPNLPEYPIATLGAIEAGLTVTTVNPVYTPDEIARQLTFSGAKFLVGTVSGFATLSQASK 194
            .:.:..|...|...|..|.:.||....||.|.:     |:.||.:     :.||.....:|:|:.
Human  1048 NVVLLYPPGIELIAAFYGCLYAGCIPVTVRPPH-----AQNLTAT-----LPTVRMIVDVSKAAC 1102

  Fly   195 LVGRQIPIAVVRTSAEEALPEGAIDFSELTSTQNVRYEDL---KAP---KEASADDMVFLPFSSG 253
            ::..|..:.::| |.|.|   .|:|..  |....:..:||   :.|   |..:.:.:.:|.||..
Human  1103 ILTSQTLMRLLR-SREAA---AAVDVK--TWPTIIDTDDLPRKRLPQLYKPPTPEMLAYLDFSVS 1161

  Fly   254 TTGLPKGVMLSHNNITSNCEQV----------QASLPLD---------------LMGPQNTLPGV 293
            |||:..||.:||:.:.:.|..:          |.::.||               ..|.|:.|   
Human  1162 TTGMLTGVKMSHSAVNALCRAIKLQCELYSSRQIAICLDPYCGLGFALWCLCSVYSGHQSVL--- 1223

  Fly   294 LPFFHIYGLTVVMLSKLGQ------GCRLATMP-CFKPDDFMRSLDKYQGSILNLV--------- 342
            :|...:.....:.||.:.|      .|..:.|. |.|.......:.|.:|..|:.|         
Human  1224 IPPMELENNLFLWLSTVNQYKIRDTFCSYSVMELCTKGLGNQVEVLKTRGINLSCVRTCVVVAEE 1288

  Fly   343 -PPIALFMINHPKLTQETAPHLKVV----------------MSGAAPIG--------QHDVERFL 382
             |.:|| ..:..||.::.....:.|                .||..|..        :||..|.:
Human  1289 RPRVAL-QQSFSKLFKDIGLSPRAVSTTFGSRVNVAICLQGTSGPDPTTVYVDLKSLRHDRVRLV 1352

  Fly   383 NKFPNTVFKQGYGMTEASPVVLLTPEGNKVYASTGVLPASTEAKIVPLDGSDAKGVGPRTTGELC 447
            .:              .:|..||..|..|      :||.   .|:|.::......||....||:.
Human  1353 ER--------------GAPQSLLLSESGK------ILPG---VKVVIVNPETKGPVGDSHLGEIW 1394

  Fly   448 VRGPQVMAGY--------LNNDEAN-QVTFYPGN-----WLRSGDVAFY----------DEDGLF 488
            |..|...:||        |..|..| :::|  |:     |.|:|.:.|.          :.....
Human  1395 VNSPHTASGYYTIYDSETLQADHFNTRLSF--GDAAQTLWARTGYLGFVRRTELTAATGERHDAL 1457

  Fly   489 YITDRMKELIKVKGFQVPPAELE-AVLRDHPKILEAAVFGIPHEFNGEAPRAIVVLRQGEKASAE 552
            |:...:.|.::::|.:..|.::| :|.|.|..|.|.|||...:..      .:||...|.:..|.
Human  1458 YVVGALDETLELRGLRYHPIDIETSVSRIHRSIAECAVFTWTNLL------VVVVELCGSEQEAL 1516

  Fly   553 EISAYVAERV--AHYKKLEGGVIFVDE--VPKNPTGKILRRELKEKF 595
            ::...|...|  .|| .:.|.|:.||.  :|.|..|:..|..|::.|
Human  1517 DLVPLVTNVVLEEHY-LIVGVVVVVDPGVIPINSRGEKQRMHLRDSF 1562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdgyNP_001188590.1 CaiC 77..595 CDD:223395 137/630 (22%)
Firefly_Luc_like 99..587 CDD:213279 129/588 (22%)
DIP2BNP_775873.2 DMAP_binding 14..131 CDD:283995
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..167
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..201
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..246
CaiC 336..912 CDD:223395
AFD_class_I 360..924 CDD:302604
AMP-binding 995..1470 CDD:278902 108/524 (21%)
AFD_class_I 1012..1565 CDD:302604 134/608 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.