DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdgy and Acsm1

DIOPT Version :9

Sequence 1:NP_001188590.1 Gene:pdgy / 32426 FlyBaseID:FBgn0027601 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001101972.2 Gene:Acsm1 / 361638 RGDID:1306813 Length:577 Species:Rattus norvegicus


Alignment Length:600 Identity:157/600 - (26%)
Similarity:253/600 - (42%) Gaps:98/600 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KFLH----YSPE--------DGYYKTSPFDPVTIPNVPLH--EYVWRDFKKWERR--TAAVCVIT 99
            ||||    :.|:        ||..:.:.:|.....|...|  :| |...:...:|  ..|:..:.
  Rat    15 KFLHRFSLHRPQLHRWLISGDGAQRWNDYDSPEEFNFASHVLDY-WAQMEGEGKRGPGPALWWVN 78

  Fly   100 DR----QYTFAQMRDASAAFAVRLQTKFNLQKPDVLAICLPNLPEYPIATLGAIEAGLTVTTVNP 160
            |:    :::|.::||.|...|...:....||..|.||:.||.:||:.:.|:|.|..|:.......
  Rat    79 DQGDEIKWSFRELRDLSRRAANVFEQTCGLQHGDRLALILPRVPEWWLVTVGCIRTGVIFIPGTA 143

  Fly   161 VYTPDEIARQLTFSGAKFLVGTVSGFATL-SQASKLVGRQIPIAVVRTSAEEALPEGAIDFSELT 224
            .....:|..::..|.||.:|.|.|....: |.||:..|.:..|.|     .:...||.::|..|.
  Rat   144 QMKAKDILYRIQMSQAKAIVTTDSLVPEVESVASECPGLKTKIVV-----SDHNHEGWLNFRTLL 203

  Fly   225 STQNVRYEDLKAPKEASADDMVFLPFSSGTTGLPKGVMLSHNNITSNCEQVQASLPLDLMGPQNT 289
            .:.:   .|....|....|.||.. |:|||||.||  |..||               ..:..:::
  Rat   204 RSAS---PDHTCVKSKMKDPMVIF-FTSGTTGYPK--MAKHN---------------QGLAFRSS 247

  Fly   290 LPGVLPFFHIYGLTVV-MLSKLG-----QGCRL------AT-----MPCFKPDDFMRSLDKYQGS 337
            :|....|..:....|: .:|..|     .||.|      ||     :|.|.|...:.:|.||..:
  Rat   248 VPSCRKFLKLKTSDVIWCMSDPGWILATVGCLLEPWTAGATVFVHNLPQFDPKVIVETLFKYPIT 312

  Fly   338 ILNLVPPIALFMINHPKLTQETAPHLKVVMSGAAPIGQHDVERFLNKFPNTVFKQGYGMTEASPV 402
            .. |..|....|:....::....|.|:...:|...:...:.|::..:...:: .:.||.:|....
  Rat   313 QC-LAAPAVYRMVLQKNISNLRFPTLEHCATGGESLLPEEYEQWKQRTGLSI-HEVYGQSETGIT 375

  Fly   403 VLLTPEGNKVYASTGVLPASTEAKIVPLDGS--DAKG--VGPRTTGELCVR-GPQ----VMAGYL 458
            .       .::....|...|....|:|.|..  |.||  :.|.|.|.:.:| .|.    :..||.
  Rat   376 C-------AIFREMKVKRGSIGKAILPFDIQIIDEKGNILPPNTEGYIGIRIKPTRPLGLFVGYE 433

  Fly   459 NNDE-ANQVTFYPGNWLRSGDVAFYDEDGLFYITDRMKELIKVKGFQVPPAELEAVLRDHPKILE 522
            |:.| .::|..  |::..|||.|..||||..:...|..::|...|:::.|.|:|..|.:||.:.|
  Rat   434 NSPEKTSEVEC--GDFYNSGDRATIDEDGYIWFLGRSDDVINASGYRIGPTEVENALVEHPAVSE 496

  Fly   523 AAVFGIPHEFNGEAPRAIVVLR-----QGEKASAEEISAYVAERVAHYK---KLEGGVIFVDEVP 579
            :||...|.:..||..:|.:||.     ..::...:|:..:|....|.||   |:|    ||.|:|
  Rat   497 SAVVSSPDKDRGEVVKAFIVLNPEFLSHDQEQLIKELQEHVKSVTAPYKYPRKVE----FVSELP 557

  Fly   580 KNPTGKILRRELKEK 594
            |..||||.|:||:.|
  Rat   558 KTITGKIKRKELRNK 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdgyNP_001188590.1 CaiC 77..595 CDD:223395 147/561 (26%)
Firefly_Luc_like 99..587 CDD:213279 138/527 (26%)
Acsm1NP_001101972.2 AFD_class_I 46..573 CDD:302604 148/568 (26%)
Acs 46..570 CDD:223442 147/565 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333840at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.