DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdgy and ACSM6

DIOPT Version :9

Sequence 1:NP_001188590.1 Gene:pdgy / 32426 FlyBaseID:FBgn0027601 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_997204.2 Gene:ACSM6 / 142827 HGNCID:31665 Length:480 Species:Homo sapiens


Alignment Length:443 Identity:98/443 - (22%)
Similarity:161/443 - (36%) Gaps:60/443 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 VWRDFKKWERRTAAVCVITDRQYTFAQMRDASAAFAVRLQTKFNLQKPDVLAICLPNLPEYPIAT 145
            :|:...|.|          :.:::|.:|...|...|..|.....|...|.|.|.||..||.....
Human    74 LWKVSAKGE----------EDKWSFERMTQLSKKAASILSDTCALSHGDRLMIILPPTPEAYWIC 128

  Fly   146 LGAIEAGLTVTTVNPVYTPDEIARQLTFSGAKFLVGTVSGFATLSQASKLVGRQIPIAVVRTSAE 210
            |..:..|:|....:|..|..:|..||..|.|:.:|...:....::.|..    ..|....:....
Human   129 LACVRLGITFVPGSPQLTAKKIRYQLRMSKAQCIVANEAMAPVVNSAVS----DCPTLKTKLLVS 189

  Fly   211 EALPEGAIDFSELTSTQNVRYEDLKAPKEA-----SADDMVFLPFSSGTTGLPKGVMLSHNNITS 270
            :...:|.:||.:|.        .:..||:.     |.|.|... |:.||||.||.|..|...:..
Human   190 DKSYDGWLDFKKLI--------QVAPPKQTYMRTKSQDPMAIF-FTKGTTGAPKMVEYSQYGLGM 245

  Fly   271 NCEQVQASLPLDLMGPQNTLPGVLPFFHIYGLTVVMLSKLG---QGC--RLATMPCFKPDDFMRS 330
            ...|..... :||. |.:.|..:...|   |.::.:.:.||   ||.  .|..||.|.|:..:..
Human   246 GFSQASRRW-MDLQ-PTDVLWSLGDAF---GGSLSLSAVLGTWFQGACVFLCHMPTFCPETVLNV 305

  Fly   331 LDKYQGSILNLVPPIALFMINHPKLTQETAPHLKVVMSGAAPIGQHDVERFLNKFPNTVFKQGYG 395
            |.::..:.|:..|.:...::.|...|......||..::...||....:|.: .:.......:|||
Human   306 LSRFPITTLSANPEMYQELLQHKCFTSYRFKSLKQCVAAGGPISPGVIEDW-KRITKLDIYEGYG 369

  Fly   396 MTEASPVVLLTPEGNKVYASTGVLPASTEAKIVPLDGSDAKGVGPRTTGELCVRGPQVMAGYLNN 460
            .||..   ||......:......|.......||.:...::..:.|...|.:.:|       ...|
Human   370 QTETG---LLCATSKTIKLKPSSLGKPLPPYIVQIVDENSNLLPPGEEGNIAIR-------IKLN 424

  Fly   461 DEANQVTFYPGNW-----------LRSGDVAFYDEDGLFYITDRMKELIKVKG 502
            ..|:....:..:|           ..:||....||||.|:.:.|:.::....|
Human   425 QPASLYCPHMVSWEEYASARGHMLYLTGDRGIMDEDGYFWWSGRVDDVANALG 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdgyNP_001188590.1 CaiC 77..595 CDD:223395 98/443 (22%)
Firefly_Luc_like 99..587 CDD:213279 95/425 (22%)
ACSM6NP_997204.2 AFD_class_I 45..480 CDD:302604 98/443 (22%)
AMP-binding 76..472 CDD:278902 96/434 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333840at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.