DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdgy and SLC27A2

DIOPT Version :9

Sequence 1:NP_001188590.1 Gene:pdgy / 32426 FlyBaseID:FBgn0027601 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_003636.2 Gene:SLC27A2 / 11001 HGNCID:10996 Length:620 Species:Homo sapiens


Alignment Length:539 Identity:116/539 - (21%)
Similarity:199/539 - (36%) Gaps:90/539 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 VWRDFKKWERRT--AAVCVITDRQYTFAQMRDASAAFAVRLQTKFNLQKPDVLAICLPNLPEYPI 143
            :.|.|.:..|:|  ....:..|...|:||:...|...|..|.....|::.|.:|:.:.|.|.|..
Human    55 ILRAFLEKARQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVW 119

  Fly   144 ATLGAIEAGLTVTTVNPVYTPDEIARQLTFSGAKFLVGTVSGFATLSQASKLVGRQIPIAVVRTS 208
            ..||.::.|..:..:|.......:.......|||.|               ||..::..||    
Human   120 LWLGLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVL---------------LVSPELQAAV---- 165

  Fly   209 AEEALPE-----------------GAIDFSELTSTQNVRYEDLKAPKEASADDMVFLP----FSS 252
             ||.||.                 ..|| |.|.....|..|.:  |:...::.....|    ::|
Human   166 -EEILPSLKKDDVSIYYVSRTSNTDGID-SFLDKVDEVSTEPI--PESWRSEVTFSTPALYIYTS 226

  Fly   253 GTTGLPKGVMLSHNNITSNCEQVQAS-LPLDLMGPQNTLPGVLPFFHIYGLTVVMLSKLGQGCRL 316
            |||||||..|::|..|.........| |..|     :.:...|||:|...|.:.:...:..|..|
Human   227 GTTGLPKAAMITHQRIWYGTGLTFVSGLKAD-----DVIYITLPFYHSAALLIGIHGCIVAGATL 286

  Fly   317 ATMPCFKPDDFMRSLDKYQGSILNLVPPIALFMINHPKLTQETAPHLKVVMSGAAPIGQHDVER- 380
            |....|....|.....||..:::..:..:..::.|.|:...:....:::.:....   :.||.| 
Human   287 ALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGL---RGDVWRQ 348

  Fly   381 FLNKFPNTVFKQGYGMTEASPVVLLTPEGNKVYASTGVLPASTEAKIVPLD--GSDAKGVGP-RT 442
            |:.:|.:....:.|..||.:  :.......||.|...|  ...:.||:..|  ..|.:...| |.
Human   349 FVKRFGDICIYEFYAATEGN--IGFMNYARKVGAVGRV--NYLQKKIITYDLIKYDVEKDEPVRD 409

  Fly   443 TGELCVRGPQVMAGYLNNDEANQVTFYPGN---------------------WLRSGDVAFYDEDG 486
            ....|||.|:...|.| ..:..|:|.:.|.                     :..|||:...|.:.
Human   410 ENGYCVRVPKGEVGLL-VCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHEN 473

  Fly   487 LFYITDRMKELIKVKGFQVPPAELEAVLRDHPKILEAAVFGI---PHEFNGEAPRAIVVLRQGEK 548
            ..|..||:.:..:.||..|...|:...:.....:.|..|:|:   .||  |....|.:.:::..:
Human   474 FIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHE--GRIGMASIKMKENHE 536

  Fly   549 ASAEEISAYVAERVAHYKK 567
            ...:::..::|:.:..|.:
Human   537 FDGKKLFQHIADYLPSYAR 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdgyNP_001188590.1 CaiC 77..595 CDD:223395 116/539 (22%)
Firefly_Luc_like 99..587 CDD:213279 112/519 (22%)
SLC27A2NP_003636.2 hsFATP2a_ACSVL_like 74..610 CDD:341261 112/520 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.