DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdgy and cacna1g

DIOPT Version :9

Sequence 1:NP_001188590.1 Gene:pdgy / 32426 FlyBaseID:FBgn0027601 Length:597 Species:Drosophila melanogaster
Sequence 2:XP_031750725.1 Gene:cacna1g / 100497283 XenbaseID:XB-GENE-993391 Length:2361 Species:Xenopus tropicalis


Alignment Length:234 Identity:46/234 - (19%)
Similarity:71/234 - (30%) Gaps:77/234 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 NHPKLTQETAPHLKVVMSGAAPIGQHDVERFLNKFPNTVFKQGYGMTEASPVVLLTPEGNKVYAS 415
            |:|.|....:|.::|   .|.|:...::....|..|..||.....:.|..              |
 Frog   560 NYPTLHPSASPDIQV---DAEPVEPSEITSDANIHPLPVFNSMNRLLETQ--------------S 607

  Fly   416 TGVLPASTEAKIVPLDGSDAKGVGPRTTGELCVRGPQVMAGYLNNDEANQVTFYPGNWLRSGDVA 480
            ||:     ...:..:.|..|........||.|        .:....|           ||..:..
 Frog   608 TGI-----GRGVCKISGQTANLESGSCDGEKC--------SHCKETE-----------LRDTEGP 648

  Fly   481 FYDEDGLFYIT--------DRMKELIKVKGFQVPPAELE----AVLRDHPKILEAAVFGIPHEFN 533
            ..|.||.:..|        .:..|..:.|.....|::|:    .|.....||:::..||      
 Frog   649 ESDSDGCYEFTQDPQGSEQQQQTEAKRAKSRSQIPSKLQQLWKMVCETFRKIVDSKYFG------ 707

  Fly   534 GEAPRAIVV------LRQG--------EKASAEEISAYV 558
                |.|::      |..|        |..:|.|||..|
 Frog   708 ----RGIMIAILINTLSMGIEYHEQPEELTNALEISNIV 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdgyNP_001188590.1 CaiC 77..595 CDD:223395 46/234 (20%)
Firefly_Luc_like 99..587 CDD:213279 46/234 (20%)
cacna1gXP_031750725.1 Ion_trans 52..375 CDD:395416
Ion_trans 703..932 CDD:395416 12/50 (24%)
Ion_trans 1227..1499 CDD:395416
Ion_trans 1568..1809 CDD:395416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165168230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.