Sequence 1: | NP_001188590.1 | Gene: | pdgy / 32426 | FlyBaseID: | FBgn0027601 | Length: | 597 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031750725.1 | Gene: | cacna1g / 100497283 | XenbaseID: | XB-GENE-993391 | Length: | 2361 | Species: | Xenopus tropicalis |
Alignment Length: | 234 | Identity: | 46/234 - (19%) |
---|---|---|---|
Similarity: | 71/234 - (30%) | Gaps: | 77/234 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 351 NHPKLTQETAPHLKVVMSGAAPIGQHDVERFLNKFPNTVFKQGYGMTEASPVVLLTPEGNKVYAS 415
Fly 416 TGVLPASTEAKIVPLDGSDAKGVGPRTTGELCVRGPQVMAGYLNNDEANQVTFYPGNWLRSGDVA 480
Fly 481 FYDEDGLFYIT--------DRMKELIKVKGFQVPPAELE----AVLRDHPKILEAAVFGIPHEFN 533
Fly 534 GEAPRAIVV------LRQG--------EKASAEEISAYV 558 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pdgy | NP_001188590.1 | CaiC | 77..595 | CDD:223395 | 46/234 (20%) |
Firefly_Luc_like | 99..587 | CDD:213279 | 46/234 (20%) | ||
cacna1g | XP_031750725.1 | Ion_trans | 52..375 | CDD:395416 | |
Ion_trans | 703..932 | CDD:395416 | 12/50 (24%) | ||
Ion_trans | 1227..1499 | CDD:395416 | |||
Ion_trans | 1568..1809 | CDD:395416 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165168230 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |