DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdgy and acsbg1

DIOPT Version :9

Sequence 1:NP_001188590.1 Gene:pdgy / 32426 FlyBaseID:FBgn0027601 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001121495.1 Gene:acsbg1 / 100158596 XenbaseID:XB-GENE-985321 Length:254 Species:Xenopus tropicalis


Alignment Length:277 Identity:61/277 - (22%)
Similarity:100/277 - (36%) Gaps:90/277 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QSVSETDKFLHYSPEDGYYKTS---------------------PFDPVTIPNV---------PLH 78
            :|....|:|:     ||..||:                     |..|:|:..:         ||.
 Frog     2 ESSEVADQFV-----DGPIKTTEEKLWTTEANGSVQLRIDALCPQSPITVHQMFLESVDKYGPLD 61

  Fly    79 EYVWRDFKKWERRTAAVCVITDRQYTFAQMRDASAAFAVRLQTKFNLQKPDVLAICLPNLPEYPI 143
            ....:....||.       :|...| :...|.|:.:|     .|..|::...:.|...|..|:.|
 Frog    62 ALSTKRNGIWEH-------VTFMDY-YKLCRQAAKSF-----LKLGLERFHSVGILGFNSEEWFI 113

  Fly   144 ATLGAIEAGLTVTTVNPVYTPDEIARQLTFSGAKFLVGTVSGFATLSQASKLVGRQI-------- 200
            :.:|.:.||..:|.:....:|:  |.....|..|..:..|.   ...|..|::  ||        
 Frog   114 SAIGTVFAGGIITGIYTTNSPE--ACHYVASDCKMNIIVVE---NQKQLEKIL--QIWDGLPHLK 171

  Fly   201 PIAVVRTSAEEALP-----EGAIDFSELTSTQNVRYEDLKAPKEASADDMV---------FLPFS 251
            .:...:.:.:|..|     |..::|.             |...:|..||::         .|.::
 Frog   172 AVVQYKGNLQEKRPNLYTWEEFMEFG-------------KDIADAHLDDIINSQKANQCCVLIYT 223

  Fly   252 SGTTGLPKGVMLSHNNI 268
            |||||.||||||||:|:
 Frog   224 SGTTGNPKGVMLSHDNV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdgyNP_001188590.1 CaiC 77..595 CDD:223395 50/214 (23%)
Firefly_Luc_like 99..587 CDD:213279 47/192 (24%)
acsbg1NP_001121495.1 AFD_class_I 66..>240 CDD:302604 48/206 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.