DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Flo2 and FLOT1

DIOPT Version :9

Sequence 1:NP_001259553.1 Gene:Flo2 / 32425 FlyBaseID:FBgn0264078 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_197907.1 Gene:FLOT1 / 832596 AraportID:AT5G25250 Length:470 Species:Arabidopsis thaliana


Alignment Length:400 Identity:84/400 - (21%)
Similarity:153/400 - (38%) Gaps:94/400 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVY 181
            |....:.:.:...:||..|.:..::|:||::|...:|...|.:....::.:.|:.|.:..:|.:.
plant    89 KDSNHVHELVEGVIEGETRVLAASMTMEEIFKGTKEFKKEVFDKVQLELNQFGLVIYNANVKQLV 153

  Fly   182 D--DVQYLASLGKAQTAVVKRDADAGVAEANR--DAGIRE-------------AECEKSAM---- 225
            |  ..:|.:.||:.........|...|:||..  :.|.:|             ||.:..:|    
plant   154 DVPGHEYFSYLGQKTQMEAANQARIDVSEAKMKGEIGAKERTGLTLQNAAKIDAESKIISMQRQG 218

  Fly   226 -----DVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVV 285
                 ::|..|:.|:.:|           .:|.:.|||.::||       :::....::.|:..|
plant   219 EGTKEEIKVRTEVKVFEN-----------QKEADVAKANAELA-------MKKAAWTKDAQVAEV 265

  Fly   286 ERRKQIEIESQEVQ---RKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGS 347
            |..|.:.:...|:|   .|...||.|.||.||       .|::|......:...|..|...|...
plant   266 EATKAVALREAELQTQVEKMNALTRTEKLKAE-------FLSKASVEYETKVQEANWELYNKQKQ 323

  Fly   348 AEAHAIELVGKAEAERMRMKAHVYKQYGDA-------------------AIMN--IVLESLPKIA 391
            |||...|...:|||::.:..|..|.:..:|                   |:.|  ..|.....|.
plant   324 AEAVLYEKQKQAEAQKAQADAAFYSKQKEAEGLVALASAQGTYLRTLLDAVQNDYSCLRDFLMIN 388

  Fly   392 AEVAAPLAKTDEIVLI----------------GGNDNITNDVTRLVAQLPPSINAL---TGVDLS 437
            ..:...:|||:.:.:.                ||:.|...|:..|...|||.::.:   ||:...
plant   389 NGIYQEIAKTNAMAVRDLQPKISVWNHGGEQGGGSGNAMKDIAGLYKMLPPVLDTVYEQTGMQPP 453

  Fly   438 KVLSKIPGAK 447
            ..:..:.||:
plant   454 AWIGTLRGAE 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Flo2NP_001259553.1 SPFH_flotillin 34..201 CDD:259798 17/85 (20%)
PHB 110..281 CDD:214581 36/189 (19%)
SPFH_like <286..374 CDD:302763 26/90 (29%)
Flot 337..>410 CDD:292597 21/109 (19%)
FLOT1NP_197907.1 SPFH_flotillin 28..175 CDD:259798 17/85 (20%)
ATP-synt_B <258..331 CDD:304375 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3805
eggNOG 1 0.900 - - E1_COG2268
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I2168
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D812555at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.