DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9514 and AgaP_AGAP012262

DIOPT Version :9

Sequence 1:NP_572981.1 Gene:CG9514 / 32418 FlyBaseID:FBgn0030592 Length:726 Species:Drosophila melanogaster
Sequence 2:XP_001689244.1 Gene:AgaP_AGAP012262 / 5667855 VectorBaseID:AGAP012262 Length:334 Species:Anopheles gambiae


Alignment Length:405 Identity:62/405 - (15%)
Similarity:136/405 - (33%) Gaps:142/405 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 GKVLGGSSVLNTMLYIRGNKRDFDQWADFGNPGWSYEDILPYFRKSEDQRNPYLARNKRYHGTGG 238
            |:.|.......|:|.::|::               ..|:|   ..||..:               
Mosquito    49 GRYLAARDTNKTVLVLKGSR---------------CNDVL---EPSEPSK--------------- 80

  Fly   239 LWTVQDAPYNTPIGPAFLQAGEEMGYDIVD--VNGEQQTGFGFYQFNMRRGSRSSTAKSFLRPAR 301
            :|        ..:...|.::...:||:.:|  ::| .:.|..|          ::...||:.|.:
Mosquito    81 MW--------LEVSYLFAESAHYLGYEFIDPFLHG-SKPGIAF----------TNQTASFIPPTQ 126

  Fly   302 ----LRPNLHVALFSHVTKVLTDPHTKRATGVQFIRDGRLQNVYATREVILSAGAIGSPHLMMLS 362
                :.|||.:.:.:...:::.:..:..|.||:...:.....::||.|:|::             
Mosquito   127 QLYAVDPNLKMLIDARPQRIIYNKASSTALGVEVSINYESLYIFATEELIIA------------- 178

  Fly   363 GIGHGEELGRVGIPLVQHLPGVGQNLQDHIAVGGIAFLIDYPISIVMKRMVNINTALRYAITEDG 427
                                  |:.|:|:..:..:..|   |..::.|.:.||            
Mosquito   179 ----------------------GRCLEDYKLISQVDIL---PWDLLSKLLSNI------------ 206

  Fly   428 PLTSSIGLEAVAFINTKYANASDDWPDMNFMMTSASVMSDGGSQVKTAHGL--TDEFYQEVFGEV 490
            ||..::....:|.|               |.|.:....:......|..:.|  |:.|.:.:....
Mosquito   207 PLEIALKSPIIAPI---------------FRMNATPTFNHTIEPNKQPYCLLATELFIETLSKSQ 256

  Fly   491 NNRDVF---GVFPMMLRPKSRGYIKLASKNPLRY-----PLLYHNYLTHPDD----VNVLREGVK 543
            .|:...   |:     :|.::..|.:..:.|.|:     .::|.:..|..:|    ..||.:.:.
Mosquito   257 TNQTTASKEGI-----QPNAKVNIIVNERAPDRWIGFNPSVIYQDTATELNDPATVYKVLADTID 316

  Fly   544 AAVAMGETQAMKRFG 558
            ..:.:|.:|..::.|
Mosquito   317 KCMKIGTSQTFQQLG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9514NP_572981.1 PRK02106 95..679 CDD:235000 62/405 (15%)
NADB_Rossmann 96..>126 CDD:304358
NADB_Rossmann 167..391 CDD:304358 32/222 (14%)
GMC_oxred_C 505..648 CDD:282984 12/63 (19%)
AgaP_AGAP012262XP_001689244.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.