DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9514 and AgaP_AGAP012882

DIOPT Version :9

Sequence 1:NP_572981.1 Gene:CG9514 / 32418 FlyBaseID:FBgn0030592 Length:726 Species:Drosophila melanogaster
Sequence 2:XP_561565.1 Gene:AgaP_AGAP012882 / 3292665 VectorBaseID:AGAP012882 Length:190 Species:Anopheles gambiae


Alignment Length:155 Identity:76/155 - (49%)
Similarity:99/155 - (63%) Gaps:1/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 MMLRPKSRGYIKLASKNPLRYPLLYHNYLTHPDDVNVLREGVKAAVAMGETQAMKRFGARYWNKP 565
            |:.||.|.|:::||||||..:..::.||..:|.|:.||.||:|.|.|:..|.||:...|...:..
Mosquito     1 MLSRPLSTGWLELASKNPHDHIRIHPNYFDNPKDMMVLIEGLKFAEALANTTAMRNINATLLDYS 65

  Fly   566 VPNCKHLT-LYTDDYWNCFIRQYTMTIYHMSGTAKMGPPTDPWAVVDPQLRVYGIPGLRVIDASI 629
            ...|:... |..||::.|.:|.||.||||..|||||||.|||.||||..|||:.|.||||:||||
Mosquito    66 RSACRASNFLNKDDFYTCLVRHYTQTIYHPCGTAKMGPVTDPMAVVDRFLRVHHIGGLRVVDASI 130

  Fly   630 MPAITNGNIHAPVVMIGEKGADMIK 654
            .|.||.||.:.|.:..|||.||::|
Mosquito   131 FPVITTGNTNVPTIATGEKAADLVK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9514NP_572981.1 PRK02106 95..679 CDD:235000 76/155 (49%)
NADB_Rossmann 96..>126 CDD:304358
NADB_Rossmann 167..391 CDD:304358
GMC_oxred_C 505..648 CDD:282984 69/143 (48%)
AgaP_AGAP012882XP_561565.1 GMC_oxred_C 5..150 CDD:282984 70/144 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2303
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D173099at33208
OrthoFinder 1 1.000 - - FOG0000165
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.