DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9518 and AT1G14180

DIOPT Version :9

Sequence 1:NP_001285249.1 Gene:CG9518 / 32416 FlyBaseID:FBgn0030590 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_563938.5 Gene:AT1G14180 / 837977 AraportID:AT1G14180 Length:348 Species:Arabidopsis thaliana


Alignment Length:412 Identity:76/412 - (18%)
Similarity:122/412 - (29%) Gaps:166/412 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 VAIVQDRFNPTAVTFQYVLRER--------GPMTTLGGVEGLA---------------FVHTPYS 406
            ||...||.|.|:..|.:.|.|.        .|.::...|.||.               .:.:|..
plant     7 VAAKSDRSNSTSGDFSFGLHEPYWRTNTSFSPPSSRWDVHGLMDGISCYGSSTSSNANVLRSPDL 71

  Fly   407 NRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESV-----------------YQEVYHPI---- 450
            :::|.|....|..|     :.....||::.|...:|                 ..:..|||    
plant    72 SQALHWTPNDFESA-----TRRDQIVKQLPGTSRNVGIGDSEPGRNSSSRRFFLSKPVHPILHPS 131

  Fly   451 ----------ANKDSWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIA 505
                      |:..||:..    .|.|..||.:..      |:::.|            ..:..|
plant   132 DNVRDTASDSADACSWSSG----TPSSIDSVDVPE------PVLDWN------------NNSTKA 174

  Fly   506 LRVAEAQVFK------------QFGSR--LWRKPLP-----NCKQHKFLSDAYLECHVRTISMTI 551
            .:||.:..||            .:|||  :..:.:|     :| ||.|        ||..:..:.
plant   175 QQVAASSTFKCGLCNRYLSQKSPWGSRSIVRNRDMPVTGVLSC-QHVF--------HVECLDQST 230

  Fly   552 --------YHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEK 608
                    ..|..|.:.|..:....:| |||:               |....|.::.|  ....:
plant   231 PKIQRNDPLCPICTKQEGEHFKSNNIV-PRLK---------------PLYEDGPSSRP--WGCAQ 277

  Fly   609 GADLIKEDWLTNPEYKVKRQANRLRDPDPASSNIQGIITLPNNITQGDSSNISDRSNMESNFSNS 673
            ..|.: |..:..|........||                  |.|.:    ::|.|.|...:||..
plant   278 AGDCV-ESAVNVPPKNTMMMINR------------------NRIRK----SLSLRGNSSKDFSRK 319

  Fly   674 SHINNINFNSNSNSSNIESSSN 695
            .        ..|||..:|:.:|
plant   320 M--------KRSNSVAMENLAN 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9518NP_001285249.1 PRK02106 56..614 CDD:235000 60/329 (18%)
NADB_Rossmann 128..351 CDD:304358
GMC_oxred_C 465..608 CDD:282984 31/169 (18%)
AT1G14180NP_563938.5 RING_Ubox 185..243 CDD:418438 11/66 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2303
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.