DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9518 and AT4G19380

DIOPT Version :9

Sequence 1:NP_001285249.1 Gene:CG9518 / 32416 FlyBaseID:FBgn0030590 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_001329018.1 Gene:AT4G19380 / 827679 AraportID:AT4G19380 Length:768 Species:Arabidopsis thaliana


Alignment Length:597 Identity:125/597 - (20%)
Similarity:212/597 - (35%) Gaps:158/597 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAY------KT 116
            |.:||||||.|.|.|..|::. .:|||:||:|   |..:  .|..:.|:...:|..|      .|
plant   267 DAVVVGSGSGGGVAAGVLAKA-GYKVLVIESG---NYYA--RSKLSLLEGQAMDDMYLSGGLLAT 325

  Fly   117 EPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVLRYFKKS 181
            ..:....|.          |..:||.|.:|:...::...|....||                   
plant   326 SDTNVVILA----------GSTVGGGSTINWSASIKTPEHVMKEWA------------------- 361

  Fly   182 EDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDI-NGAKQAGFMIAQ--- 242
            |.::.....::.|.....::..:..     :...|||.    |::|..: .|.::.|..:..   
plant   362 EKSKLEMFGSDLYREAMDVVCKRMG-----VQCGFVEE----GFNNEVLRKGCEKLGLPVKNIPR 417

  Fly   243 -------------GTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVI--IEPG-TMRAQAVE 291
                         | .::|.:..|::.:|..:....|..:......|.|:  .|.| ..:|..|.
plant   418 NAPSDHYCGFCCLG-CKKGQKQGTSETWLVDLVESDNGLILPGCQATEVMYDCEQGKKKKATGVA 481

  Fly   292 FVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLPVGENMQDHVGMGG 356
            |....::| :...|..|::.||:.||.|:..||              |::..:|.|:..|     
plant   482 FAFGEEIY-VVESRVTIVACGALRTPHLLKRSG--------------LKNSNIGRNLCLH----- 526

  Fly   357 LTFLVDKPVAIV------QDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDI 415
                   ||.:.      :|:: |......|   |.|.||.:..|. :...|:.|....:..|.:
plant   527 -------PVVMAWGWFPEEDKW-PEKKKKSY---EGGIMTAMSSVV-IEETHSSYGEMVIQTPAL 579

  Fly   416 QFHM----APASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRGSVKLRSA 476
            ...|    .|.:.:.|...|:.|        :....|..|          |||.:..|::..:: 
plant   580 HPGMFSGIIPWTSSKDFKTRMLK--------FSRTAHIFA----------LLRDKGTGTIDSKT- 625

  Fly   477 NPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYLE 541
                  .|:.|..|:  |.::|..|.:..|::..|...::.|:........|.:.   .|...:|
plant   626 ------YIDYNLNDE--DEESLKNGLERVLKILAAAGAEEIGTHHSEGRSLNVRT---ASSLEIE 679

  Fly   542 CHVRTIS----------MTIYHPCGTAKMG--PAWDPEAVVDPRLRVYGVRGLRVIDASIMPTIS 594
            ..||..|          :...|..|:.:||  |   .|:.|.|....:.|..|.|.|.|:.||..
plant   680 RFVREESSKPLKDLSGQICSAHQMGSCRMGIRP---EESAVRPTGETWEVERLFVADTSVFPTAL 741

  Fly   595 SGNTNAPVIMIA 606
            ..|....|..||
plant   742 GVNPMVTVQSIA 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9518NP_001285249.1 PRK02106 56..614 CDD:235000 125/597 (21%)
NADB_Rossmann 128..351 CDD:304358 42/242 (17%)
GMC_oxred_C 465..608 CDD:282984 35/154 (23%)
AT4G19380NP_001329018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2303
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.