DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9518 and AgaP_AGAP012882

DIOPT Version :9

Sequence 1:NP_001285249.1 Gene:CG9518 / 32416 FlyBaseID:FBgn0030590 Length:703 Species:Drosophila melanogaster
Sequence 2:XP_561565.1 Gene:AgaP_AGAP012882 / 3292665 VectorBaseID:AGAP012882 Length:190 Species:Anopheles gambiae


Alignment Length:175 Identity:77/175 - (44%)
Similarity:103/175 - (58%) Gaps:5/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 LLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRKP 525
            :|.||.|.|.::|.|.||..:..|:.||||:|.|...|:||.|.|..:|.....:...:.|....
Mosquito     1 MLSRPLSTGWLELASKNPHDHIRIHPNYFDNPKDMMVLIEGLKFAEALANTTAMRNINATLLDYS 65

  Fly   526 LPNCKQHKFLS-DAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASI 589
            ...|:...||: |.:..|.||..:.|||||||||||||..||.||||..|||:.:.||||:||||
Mosquito    66 RSACRASNFLNKDDFYTCLVRHYTQTIYHPCGTAKMGPVTDPMAVVDRFLRVHHIGGLRVVDASI 130

  Fly   590 MPTISSGNTNAPVIMIAEKGADLIKEDWLTNPEYKVKRQANRLRD 634
            .|.|::||||.|.|...||.|||:|..:..:    ::..|:.||:
Mosquito   131 FPVITTGNTNVPTIATGEKAADLVKAAYAAD----LRAHADTLRE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9518NP_001285249.1 PRK02106 56..614 CDD:235000 73/153 (48%)
NADB_Rossmann 128..351 CDD:304358
GMC_oxred_C 465..608 CDD:282984 66/143 (46%)
AgaP_AGAP012882XP_561565.1 GMC_oxred_C 5..150 CDD:282984 67/144 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2303
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D173099at33208
OrthoFinder 1 1.000 - - FOG0000165
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.