DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and GRX5

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_015266.1 Gene:GRX5 / 856048 SGDID:S000005980 Length:150 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:45/120 - (37%)
Similarity:83/120 - (69%) Gaps:7/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KATMDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHGV---QYDAHDVLQNESLRQGVKDYT 102
            :..::..:.:..||:||||.|:.|:||||.|.:.::...||   ::.|::||::..||:|:|:::
Yeast    35 RKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFAAYNVLEDPELREGIKEFS 99

  Fly   103 DWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELKKAGIISELLKAEEAKQQDDK 157
            :||||||:::|.||:||||::..|.:||:|.:.|::|    :.|..||.::..|:
Yeast   100 EWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEEA----QALVPEEEEETKDR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 38/90 (42%)
GRX5NP_015266.1 GrxD 31..137 CDD:223355 41/105 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346592
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31984
Inparanoid 1 1.050 103 1.000 Inparanoid score I1440
Isobase 1 0.950 - 0 Normalized mean entropy S489
OMA 1 1.010 - - QHG61708
OrthoFinder 1 1.000 - - FOG0003200
OrthoInspector 1 1.000 - - oto99661
orthoMCL 1 0.900 - - OOG6_101462
Panther 1 1.100 - - LDO PTHR10293
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R498
SonicParanoid 1 1.000 - - X2152
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.