DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and GRX3

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_010383.4 Gene:GRX3 / 851672 SGDID:S000002505 Length:250 Species:Saccharomyces cerevisiae


Alignment Length:94 Identity:42/94 - (44%)
Similarity:67/94 - (71%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ATMDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHGVQYDAHDVLQNESLRQGVKDYTDWPT 106
            |.:.|||....|::||||:|..|:||||..:|.|:|.|.|::...|:|::||:||.:|.:::|||
Yeast   152 ARLTKLVNAAPVMLFMKGSPSEPKCGFSRQLVGILREHQVRFGFFDILRDESVRQNLKKFSEWPT 216

  Fly   107 IPQVFINGEFVGGCDILLQ-MHQSGDLIE 134
            .||::|||||.||.||:.: :.:..|.::
Yeast   217 FPQLYINGEFQGGLDIIKESLEEDPDFLQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 40/88 (45%)
GRX3NP_010383.4 TRX_PICOT 9..106 CDD:239282
GRX_PICOT_like 154..238 CDD:239326 40/83 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.