DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and CXIP1

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_191050.1 Gene:CXIP1 / 824655 AraportID:AT3G54900 Length:173 Species:Arabidopsis thaliana


Alignment Length:115 Identity:58/115 - (50%)
Similarity:83/115 - (72%) Gaps:3/115 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TRF-LAADAATGAAVDKATMDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHGVQYDAHDVL 89
            |:| .:|.|.|....|  |::|||.:.|||:||||....|.|||||.||||::...|.::..::|
plant    58 TKFRCSASALTPQLKD--TLEKLVNSEKVVLFMKGTRDFPMCGFSNTVVQILKNLNVPFEDVNIL 120

  Fly    90 QNESLRQGVKDYTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELKKA 139
            :||.||||:|:|::|||.||::|.|||.|||||.|:..::|:|.||::||
plant   121 ENEMLRQGLKEYSNWPTFPQLYIGGEFFGGCDITLEAFKTGELQEEVEKA 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 46/87 (53%)
CXIP1NP_191050.1 GRX_PICOT_like 75..164 CDD:239326 46/88 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2925
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1993
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 1 1.000 - - FOG0003200
OrthoInspector 1 1.000 - - oto2887
orthoMCL 1 0.900 - - OOG6_101462
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.