DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and GRX4

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001030704.1 Gene:GRX4 / 820809 AraportID:AT3G15660 Length:169 Species:Arabidopsis thaliana


Alignment Length:97 Identity:40/97 - (41%)
Similarity:71/97 - (73%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KATMDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHGVQYDAHDVLQNESLRQGVKDYTDWP 105
            |..::..|:.|.|:::|||.|::|:||||:..|::::.:.|...:.::|:::.|:..||.::.||
plant    66 KDIVENDVKDNPVMIYMKGVPESPQCGFSSLAVRVLQQYNVPISSRNILEDQELKNAVKSFSHWP 130

  Fly   106 TIPQVFINGEFVGGCDILLQMHQSGDLIEELK 137
            |.||:||.|||:||.||:|.||:.|:|.::||
plant   131 TFPQIFIKGEFIGGSDIILNMHKEGELEQKLK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 36/87 (41%)
GRX4NP_001030704.1 GRX_PICOT_like 69..158 CDD:239326 36/88 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 1 1.000 - - FOG0003200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101462
Panther 1 1.100 - - LDO PTHR10293
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.