DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and CXIP2

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_565885.1 Gene:CXIP2 / 818407 AraportID:AT2G38270 Length:293 Species:Arabidopsis thaliana


Alignment Length:92 Identity:47/92 - (51%)
Similarity:67/92 - (72%) Gaps:3/92 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 MDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHGVQYDAHDVLQ---NESLRQGVKDYTDWP 105
            :|:||:.:|||.|:||:..||:||||..||.|:...||.|:..|||.   |..||:.:|:|::||
plant   197 IDRLVKESKVVAFIKGSRSAPQCGFSQRVVGILESQGVDYETVDVLDDEYNHGLRETLKNYSNWP 261

  Fly   106 TIPQVFINGEFVGGCDILLQMHQSGDL 132
            |.||:|:.||.|||||||..|:::|:|
plant   262 TFPQIFVKGELVGGCDILTSMYENGEL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 46/90 (51%)
CXIP2NP_565885.1 GIY-YIG_AtGrxS16 88..161 CDD:198404
GRX_PICOT_like 197..289 CDD:239326 47/92 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 1 1.000 - - FOG0003200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10293
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2152
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.